Showing Protein Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 (CDBP05327)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | CDBP05327 | |||||||
Secondary Accession Numbers | Not Available | |||||||
Name | Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 | |||||||
Description | Not Available | |||||||
Synonyms |
|
|||||||
Gene Name | PTPLAD2 | |||||||
Protein Type | Enzyme | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. | |||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Pathways | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 9 | |||||||
Locus | 9p21.3 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 27519.565 | |||||||
Theoretical pI | 8.579 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>gi|148226324|ref|NP_001010915.2| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 [Homo sapiens] MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV MRLCQSVSLL |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q5VWC8 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:20920 | |||||||
References | ||||||||
General References | Not Available |