| Identification |
|---|
| HMDB Protein ID
| CDBP05326 |
| Secondary Accession Numbers
| Not Available |
| Name
| Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2 |
| Description
| Not Available |
| Synonyms
|
- 3-hydroxyacyl-CoA dehydratase 2
- Protein-tyrosine phosphatase-like member B
- HACD2
|
| Gene Name
| PTPLB |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis.
|
| GO Classification
|
| Biological Process |
| fatty acid biosynthetic process |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| lyase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Fatty acid elongation | Not Available |  | | Biosynthesis of unsaturated fatty acids | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3q21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 28368.145 |
| Theoretical pI
| 9.548 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|38257153|ref|NP_940684.1| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2 [Homo sapiens]
MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSY
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6Y1H2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9640 |
| References |
|---|
| General References
| Not Available |