Showing Protein Glucoside xylosyltransferase 2 (CDBP05324)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | CDBP05324 | ||||||
Secondary Accession Numbers | Not Available | ||||||
Name | Glucoside xylosyltransferase 2 | ||||||
Description | Not Available | ||||||
Synonyms |
|
||||||
Gene Name | GXYLT2 | ||||||
Protein Type | Enzyme | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose. | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Pathways |
|
||||||
Gene Properties | |||||||
Chromosome Location | 3 | ||||||
Locus | 3p13 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 51055.05 | ||||||
Theoretical pI | 9.769 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>gi|122937187|ref|NP_001073862.1| glucoside xylosyltransferase 2 precursor [Homo sapiens] MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGAL PGASPGVRRR |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | A0PJZ3 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:33383 | ||||||
References | |||||||
General References | Not Available |