Showing Protein Glutathione S-transferase theta-2B (CDBP05307)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | CDBP05307 | ||||||||||||
| Secondary Accession Numbers | Not Available | ||||||||||||
| Name | Glutathione S-transferase theta-2B | ||||||||||||
| Description | Not Available | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | GSTT2B | ||||||||||||
| Protein Type | Enzyme | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity. | ||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Pathways |
|
||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 22 | ||||||||||||
| Locus | 22q11.23 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 27506.715 | ||||||||||||
| Theoretical pI | 6.406 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>gi|4504187|ref|NP_000845.1| glutathione S-transferase theta-2 [Homo sapiens] MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG DFILTESSAI |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | P0CG30 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | |||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:33437 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||
