| Identification |
|---|
| HMDB Protein ID
| CDBP05289 |
| Secondary Accession Numbers
| Not Available |
| Name
| Adenosine monophosphate-protein transferase FICD |
| Description
| Not Available |
| Synonyms
|
- AMPylator FICD
- FIC domain-containing protein
- Huntingtin yeast partner E
- Huntingtin-interacting protein 13
- Huntingtin-interacting protein E
- HIP-13
|
| Gene Name
| FICD |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. Able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
|
| GO Classification
|
| Biological Process |
| negative regulation of Rho GTPase activity |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| ATP binding |
| protein adenylyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12q24.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 51777.595 |
| Theoretical pI
| 7.719 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|42794620|ref|NP_009007.2| adenosine monophosphate-protein transferase FICD [Homo sapiens]
MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYL
LRSKPDRAQH
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BVA6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18416 |
| References |
|---|
| General References
| Not Available |