| Identification |
|---|
| HMDB Protein ID
| CDBP05285 |
| Secondary Accession Numbers
| Not Available |
| Name
| TFIIH basal transcription factor complex helicase XPB subunit |
| Description
| Not Available |
| Synonyms
|
- Basic transcription factor 2 89 kDa subunit
- DNA excision repair protein ERCC-3
- DNA repair protein complementing XP-B cells
- TFIIH basal transcription factor complex 89 kDa subunit
- Xeroderma pigmentosum group B-complementing protein
- BTF2 p89
- TFIIH 89 kDa subunit
- TFIIH p89
|
| Gene Name
| ERCC3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| ATP-dependent 3'-5' DNA helicase, component of the core-TFIIH basal transcription factor, involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Acts by opening DNA either around the RNA transcription start site or the DNA damage.
|
| GO Classification
|
| Biological Process |
| induction of apoptosis |
| virus-host interaction |
| transcription-coupled nucleotide-excision repair |
| viral reproduction |
| response to oxidative stress |
| positive regulation of transcription from RNA polymerase II promoter |
| 7-methylguanosine mRNA capping |
| UV protection |
| cell cycle checkpoint |
| response to hypoxia |
| protein localization |
| positive regulation of viral transcription |
| hair cell differentiation |
| transcription elongation from RNA polymerase II promoter |
| nucleotide-excision repair, DNA damage removal |
| transcription initiation from RNA polymerase II promoter |
| nucleotide-excision repair, DNA incision |
| termination of RNA polymerase I transcription |
| transcription elongation from RNA polymerase I promoter |
| transcription initiation from RNA polymerase I promoter |
| response to UV |
| DNA topological change |
| nucleotide-excision repair, DNA duplex unwinding |
| Cellular Component |
| holo TFIIH complex |
| SSL2-core TFIIH complex |
| Molecular Function |
| dATP binding |
| RNA polymerase II carboxy-terminal domain kinase activity |
| damaged DNA binding |
| ATPase activity |
| GTP binding |
| ATP binding |
| transcription factor binding |
| ATP-dependent DNA helicase activity |
| peptide binding |
| 3'-5' DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Basal transcription factors | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 2 |
| Locus
| 2q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 89276.985 |
| Theoretical pI
| 7.227 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|4557563|ref|NP_000113.1| TFIIH basal transcription factor complex helicase XPB subunit [Homo sapiens]
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD
YRLQMPLKDD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P19447 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:3435 |
| References |
|---|
| General References
| Not Available |