| Identification |
|---|
| HMDB Protein ID
| CDBP05280 |
| Secondary Accession Numbers
| Not Available |
| Name
| Elongation of very long chain fatty acids protein 5 |
| Description
| Not Available |
| Synonyms
|
- 3-keto acyl-CoA synthase ELOVL5
- ELOVL fatty acid elongase 5
- Fatty acid elongase 1
- Very-long-chain 3-oxoacyl-CoA synthase 5
- ELOVL FA elongase 5
- hELO1
|
| Gene Name
| ELOVL5 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA.
|
| GO Classification
|
| Biological Process |
| long-chain fatty-acyl-CoA biosynthetic process |
| triglyceride biosynthetic process |
| fatty acid elongation, monounsaturated fatty acid |
| very long-chain fatty acid biosynthetic process |
| fatty acid elongation, polyunsaturated fatty acid |
| alpha-linolenic acid metabolic process |
| linoleic acid metabolic process |
| Cellular Component |
| endoplasmic reticulum membrane |
| integral to membrane |
| Molecular Function |
| fatty acid elongase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Fatty acid elongation | Not Available |  | | Biosynthesis of unsaturated fatty acids | Not Available |  | | Alpha Linolenic Acid and Linoleic Acid Metabolism |    |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6p21.1-p12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 38402.505 |
| Theoretical pI
| 9.533 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|338827646|ref|NP_001229757.1| elongation of very long chain fatty acids protein 5 isoform 2 [Homo sapiens]
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NYP7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21308 |
| References |
|---|
| General References
| Not Available |