| Identification |
|---|
| HMDB Protein ID
| CDBP05262 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA replication ATP-dependent helicase/nuclease DNA2 |
| Description
| Not Available |
| Synonyms
|
- hDNA2
- DNA replication ATP-dependent helicase-like homolog
|
| Gene Name
| DNA2 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Key enzyme involved in DNA replication and DNA repair in nucleus and mitochondrion. Involved in Okazaki fragments processing by cleaving long flaps that escape FEN1: flaps that are longer than 27 nucleotides are coated by replication protein A complex (RPA), leading to recruit DNA2 which cleaves the flap until it is too short to bind RPA and becomes a substrate for FEN1. Also involved in 5'-end resection of DNA during double-strand break (DSB) repair: recruited by BLM and mediates the cleavage of 5'-ssDNA, while the 3'-ssDNA cleavage is prevented by the presence of RPA. Also involved in DNA replication checkpoint independently of Okazaki fragments processing. Possesses different enzymatic activities, such as single-stranded DNA (ssDNA)-dependent ATPase, 5'-3' helicase and endonuclease activities. While the ATPase and endonuclease activities are well-defined and play a key role in Okazaki fragments processing and DSB repair, the 5'-3' DNA helicase activity is subject to debate. According to various reports, the helicase activity is weak and its function remains largely unclear. Helicase activity may promote the motion of DNA2 on the flap, helping the nuclease function.
|
| GO Classification
|
| Biological Process |
| DNA replication checkpoint |
| DNA replication, removal of RNA primer |
| mitochondrial DNA repair |
| mitochondrial DNA replication |
| positive regulation of DNA replication |
| telomere maintenance via recombination |
| telomere maintenance via semi-conservative replication |
| S phase of mitotic cell cycle |
| DNA double-strand break processing |
| base-excision repair |
| Cellular Component |
| nucleoplasm |
| mitochondrial nucleoid |
| Molecular Function |
| 5'-3' DNA helicase activity |
| 5'-flap endonuclease activity |
| single-stranded DNA-dependent ATPase activity |
| site-specific endodeoxyribonuclease activity, specific for altered base |
| metal ion binding |
| ATP binding |
| 4 iron, 4 sulfur cluster binding |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | DNA replication | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 10 |
| Locus
| 10q21.3-q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 120413.595 |
| Theoretical pI
| 7.739 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|320461728|ref|NP_001073918.2| DNA replication ATP-dependent helicase/nuclease DNA2 [Homo sapiens]
MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEG
NCEKRLVITA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P51530 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2939 |
| References |
|---|
| General References
| Not Available |