| Identification |
|---|
| HMDB Protein ID
| CDBP05248 |
| Secondary Accession Numbers
| Not Available |
| Name
| Putative ATP-dependent RNA helicase DHX30 |
| Description
| Not Available |
| Synonyms
|
- DEAH box protein 30
|
| Gene Name
| DHX30 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA.
|
| GO Classification
|
| Cellular Component |
| mitochondrial nucleoid |
| Molecular Function |
| ATP binding |
| ATP-dependent helicase activity |
| RNA binding |
| chromatin binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 3 |
| Locus
| 3p21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 129436.68 |
| Theoretical pI
| 8.529 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|20336290|ref|NP_055781.2| putative ATP-dependent RNA helicase DHX30 isoform 2 [Homo sapiens]
MAASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEV
EGYGSKKIDA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q7L2E3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16716 |
| References |
|---|
| General References
| Not Available |