| Identification |
|---|
| HMDB Protein ID
| CDBP05243 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable ATP-dependent RNA helicase DDX60 |
| Description
| Not Available |
| Synonyms
|
- DEAD box protein 60
|
| Gene Name
| DDX60 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Positively regulates DDX58/RIG-I- and IFIH1/MDA5-dependent type I interferon and interferon inducible gene expression in response to viral infection. Binds ssRNA, dsRNA and dsDNA and can promote the binding of DDX58/RIG-I to dsRNA. Exhibits antiviral activity against hepatitis C virus and vesicular stomatitis virus (VSV).
|
| GO Classification
|
| Biological Process |
| response to virus |
| defense response to virus |
| innate immune response |
| positive regulation of MDA-5 signaling pathway |
| positive regulation of RIG-I signaling pathway |
| Cellular Component |
| cytoplasm |
| Molecular Function |
| double-stranded RNA binding |
| ATP binding |
| double-stranded DNA binding |
| single-stranded RNA binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 4 |
| Locus
| 4q32.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 197851.375 |
| Theoretical pI
| 7.599 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|222831595|ref|NP_060101.3| probable ATP-dependent RNA helicase DDX60 [Homo sapiens]
MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQ
NLHFFYLVER
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IY21 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25942 |
| References |
|---|
| General References
| Not Available |