| Identification |
|---|
| HMDB Protein ID
| CDBP05197 |
| Secondary Accession Numbers
| Not Available |
| Name
| Chromodomain-helicase-DNA-binding protein 8 |
| Description
| Not Available |
| Synonyms
|
- CHD-8
- ATP-dependent helicase CHD8
- Helicase with SNF2 domain 1
|
| Gene Name
| CHD8 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA helicase that acts as a chromatin remodeling factor and regulates transcription. Acts as a transcription repressor by remodeling chromatin structure and recruiting histone H1 to target genes. Suppresses p53/TP53-mediated apoptosis by recruiting histone H1 and preventing p53/TP53 transactivation activity. Acts as a negative regulator of Wnt signaling pathway by regulating beta-catenin (CTNNB1) activity. Negatively regulates CTNNB1-targeted gene expression by being recruited specifically to the promoter regions of several CTNNB1 responsive genes. Involved in both enhancer blocking and epigenetic remodeling at chromatin boundary via its interaction with CTCF. Acts as a suppressor of STAT3 activity by suppressing the LIF-induced STAT3 transcriptional activity. Also acts as a transcription activator via its interaction with ZNF143 by participating in efficient U6 RNA polymerase III transcription.
|
| GO Classification
|
| Biological Process |
| negative regulation of transcription, DNA-dependent |
| ATP-dependent chromatin remodeling |
| canonical Wnt receptor signaling pathway |
| negative regulation of Wnt receptor signaling pathway |
| positive regulation of transcription from RNA polymerase II promoter |
| positive regulation of transcription from RNA polymerase III promoter |
| transcription, DNA-dependent |
| negative regulation of apoptotic process |
| in utero embryonic development |
| Cellular Component |
| MLL1 complex |
| Molecular Function |
| ATP binding |
| methylated histone residue binding |
| DNA-dependent ATPase activity |
| p53 binding |
| beta-catenin binding |
| DNA helicase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Wnt signaling pathway | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 14 |
| Locus
| 14q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 290516.69 |
| Theoretical pI
| 6.471 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|282165704|ref|NP_001164100.1| chromodomain-helicase-DNA-binding protein 8 isoform 1 [Homo sapiens]
MADPIMDLFDDPNLFGLDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGN
SSASELVPPP
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HCK8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20153 |
| References |
|---|
| General References
| Not Available |