| Identification |
|---|
| HMDB Protein ID
| CDBP05172 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable cation-transporting ATPase 13A1 |
| Description
| Not Available |
| Synonyms
|
Not Available
|
| Gene Name
| ATP13A1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Not Available |
| GO Classification
|
| Biological Process |
| ATP catabolic process |
| cation transport |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| ATP binding |
| ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19p13.11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 132953.465 |
| Theoretical pI
| 8.139 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|170016077|ref|NP_065143.2| probable cation-transporting ATPase 13A1 [Homo sapiens]
MAAAAAVGNAVPCGARPCGVRPDGQPKPGPQPRALLAAGPALIANGDELVAAVWPYRRLA
LLRRLTVLPF
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HD20 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24215 |
| References |
|---|
| General References
| Not Available |