| Identification |
|---|
| HMDB Protein ID
| CDBP05169 |
| Secondary Accession Numbers
| Not Available |
| Name
| Protein arginine N-methyltransferase 7 |
| Description
| Not Available |
| Synonyms
|
- Histone-arginine N-methyltransferase PRMT7
- [Myelin basic protein]-arginine N-methyltransferase PRMT7
|
| Gene Name
| PRMT7 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Specifically mediates the symmetric dimethylation of histone H4 'Arg-3' to form H4R3me2s. Plays a role in gene imprinting by being recruited by CTCFL at the H19 imprinted control region (ICR) and methylating histone H4 to form H4R3me2s, possibly leading to recruit DNA methyltransferases at these sites. May also play a role in embryonic stem cell (ESC) pluripotency. Also able to mediate the arginine methylation of histone H2A and myelin basic protein (MBP) in vitro; the relevance of such results is however unclear in vivo.
|
| GO Classification
|
| Biological Process |
| regulation of transcription, DNA-dependent |
| transcription, DNA-dependent |
| spliceosomal snRNP assembly |
| cell differentiation |
| DNA methylation involved in gamete generation |
| regulation of gene expression by genetic imprinting |
| regulation of protein binding |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| histone methyltransferase activity (H4-R3 specific) |
| protein-arginine omega-N symmetric methyltransferase activity |
| ribonucleoprotein complex binding |
| histone binding |
| protein-arginine omega-N monomethyltransferase activity |
| [myelin basic protein]-arginine N-methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 16 |
| Locus
| 16q22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 73153.495 |
| Theoretical pI
| 5.457 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|296317343|ref|NP_001171753.1| protein arginine N-methyltransferase 7 isoform 2 [Homo sapiens]
MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRVFKPMADAAVKIVEKN
GFSDKIKVIN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NVM4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25557 |
| References |
|---|
| General References
| Not Available |