| Identification |
|---|
| HMDB Protein ID
| CDBP05163 |
| Secondary Accession Numbers
| Not Available |
| Name
| Alkylated DNA repair protein alkB homolog 1 |
| Description
| Not Available |
| Synonyms
|
- Alpha-ketoglutarate-dependent dioxygenase ABH1
- DNA lyase ABH1
- DNA oxidative demethylase ALKBH1
|
| Gene Name
| ALKBH1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Dioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation (By similarity). Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites. DNA lyase activity does not require alpha-ketoglutarate and iron.
|
| GO Classification
|
| Biological Process |
| oxidative demethylation |
| RNA repair |
| DNA demethylation |
| placenta development |
| developmental growth |
| DNA dealkylation involved in DNA repair |
| in utero embryonic development |
| neuron migration |
| neuron projection development |
| Cellular Component |
| mitochondrion |
| nuclear euchromatin |
| Molecular Function |
| ferrous iron binding |
| chemoattractant activity |
| DNA-(apurinic or apyrimidinic site) lyase activity |
| methylcytosine dioxygenase activity |
| oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 14 |
| Locus
| 14q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 43831.39 |
| Theoretical pI
| 7.077 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|87298840|ref|NP_006011.2| alkylated DNA repair protein alkB homolog 1 [Homo sapiens]
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQ
KVIKSQLNVS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q13686 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17911 |
| References |
|---|
| General References
| Not Available |