| Identification |
|---|
| HMDB Protein ID
| CDBP05148 |
| Secondary Accession Numbers
| Not Available |
| Name
| DNA dC->dU-editing enzyme APOBEC-3G |
| Description
| Not Available |
| Synonyms
|
- APOBEC-related cytidine deaminase
- APOBEC-related protein 9
- CEM-15
- Deoxycytidine deaminase
- APOBEC-related protein
- ARCD
- ARP-9
- CEM15
|
| Gene Name
| APOBEC3G |
| Protein Type
| Metal Binding |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. May also prevent the transposition of a subset of retroelements. Binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing.
|
| GO Classification
|
| Biological Process |
| defense response to virus |
| DNA cytosine deamination |
| innate immune response |
| negative regulation of transposition |
| virus-host interaction |
| base conversion or substitution editing |
| negative regulation of retroviral genome replication |
| positive regulation of defense response to virus by host |
| viral reproduction |
| Cellular Component |
| mitochondrion |
| apolipoprotein B mRNA editing enzyme complex |
| cytosol |
| Molecular Function |
| metal ion binding |
| cytidine deaminase activity |
| zinc ion binding |
| RNA binding |
| deoxycytidine deaminase activity |
| protein homodimerization activity |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q13.1-q13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 11822.52 |
| Theoretical pI
| 11.133 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|54873619|ref|NP_001006667.1| DNA dC->dU-editing enzyme APOBEC-3F isoform b [Homo sapiens]
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPR
SFIRAPFQVL
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HC16 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17357 |
| References |
|---|
| General References
| Not Available |