| Identification |
|---|
| HMDB Protein ID
| CDBP05144 |
| Secondary Accession Numbers
| Not Available |
| Name
| Probable DNA dC->dU-editing enzyme APOBEC-3B |
| Description
| Not Available |
| Synonyms
|
- Phorbolin-1-related protein
- Phorbolin-2/3
|
| Gene Name
| APOBEC3B |
| Protein Type
| Metal Binding |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Probable DNA cytidine deaminase involved in foreign DNA clearance. May provide cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses. Binds to apoB and AU-rich RNAs.
|
| GO Classification
|
| Biological Process |
| negative regulation of transposition |
| metabolic process |
| Molecular Function |
| zinc ion binding |
| hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines |
| RNA binding |
| metal ion binding |
|
| Cellular Location
|
Not Available
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 22 |
| Locus
| 22q13.1-q13.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 43107.7 |
| Theoretical pI
| 5.913 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>gi|393715119|ref|NP_001257340.1| DNA dC->dU-editing enzyme APOBEC-3B isoform b [Homo sapiens]
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY
FKPQYHAEMC
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UH17 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17352 |
| References |
|---|
| General References
| Not Available |