| Identification |
|---|
| HMDB Protein ID
| CDBP04845 |
| Secondary Accession Numbers
| Not Available |
| Name
| Potassium voltage-gated channel subfamily E member 2 |
| Description
| Not Available |
| Synonyms
|
- MinK-related peptide 1
- Minimum potassium ion channel-related peptide 1
- Potassium channel subunit beta MiRP1
|
| Gene Name
| KCNE2 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Involved in voltage-gated potassium channel activity |
| Specific Function
| Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KVLTQ1 and elicit a voltage-independent current. May associate with HCN1 and HCN2 and increase potassium current |
| GO Classification
|
| Component |
| membrane |
| cell part |
| Function |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| transporter activity |
| ion channel activity |
| cation channel activity |
| potassium channel activity |
| voltage-gated potassium channel activity |
| Process |
| establishment of localization |
| transport |
| monovalent inorganic cation transport |
| potassium ion transport |
| ion transport |
| cation transport |
|
| Cellular Location
|
- Membrane
- Single-pass type I membrane protein
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | Muscle/Heart Contraction |    | Not Available | | Acebutolol Action Pathway |    | Not Available | | Alprenolol Action Pathway |    | Not Available | | Atenolol Action Pathway |    | Not Available | | Betaxolol Action Pathway |    | Not Available |
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:2 |
| Locus
| 21q22.12 |
| SNPs
| KCNE2 |
| Gene Sequence
|
>372 bp
ATGTCTACTTTATCCAATTTCACACAGACGCTGGAAGACGTCTTCCGAAGGATTTTTATT
ACTTATATGGACAATTGGCGCCAGAACACAACAGCTGAGCAAGAGGCCCTCCAAGCCAAA
GTTGATGCTGAGAACTTCTACTATGTCATCCTGTACCTCATGGTGATGATTGGAATGTTC
TCTTTCATCATCGTGGCCATCCTGGTGAGCACTGTGAAATCCAAGAGACGGGAACACTCC
AATGACCCCTACCACCAGTACATTGTAGAGGACTGGCAGGAAAAGTACAAGAGCCAAATC
TTGAATCTAGAAGAATCGAAGGCCACCATCCATGAGAACATTGGTGCGGCTGGGTTCAAA
ATGTCCCCCTGA
|
| Protein Properties |
|---|
| Number of Residues
| 123 |
| Molecular Weight
| 14471.4 |
| Theoretical pI
| 5.65 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Potassium voltage-gated channel subfamily E member 2
MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMF
SFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFK
MSP
|
| External Links |
|---|
| GenBank ID Protein
| 4704423 |
| UniProtKB/Swiss-Prot ID
| Q9Y6J6 |
| UniProtKB/Swiss-Prot Entry Name
| KCNE2_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AF071002 |
| GeneCard ID
| KCNE2 |
| GenAtlas ID
| KCNE2 |
| HGNC ID
| HGNC:6242 |
| References |
|---|
| General References
| Not Available |