Identification
HMDB Protein ID CDBP04807
Secondary Accession Numbers Not Available
Name Cannabinoid receptor 1
Description Not Available
Synonyms
  1. CANN6
  2. CB-R
  3. CB1
Gene Name CNR1
Protein Type Receptor
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
cannabinoid receptor activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Pathways
Gene Properties
Chromosome Location Chromosome:6
Locus 6q14-q15
SNPs CNR1
Gene Sequence
>1419 bp
ATGAAGTCGATCCTAGATGGCCTTGCAGATACCACCTTCCGCACCATCACCACTGACCTC
CTGTACGTGGGCTCAAATGACATTCAGTACGAAGACATCAAAGGTGACATGGCATCCAAA
TTAGGGTACTTCCCACAGAAATTCCCTTTAACTTCCTTTAGGGGAAGTCCCTTCCAAGAG
AAGATGACTGCGGGAGACAACCCCCAGCTAGTCCCAGCAGACCAGGTGAACATTACAGAA
TTTTACAACAAGTCTCTCTCGTCCTTCAAGGAGAATGAGGAGAACATCCAGTGTGGGGAG
AACTTCATGGACATAGAGTGTTTCATGGTCCTGAACCCCAGCCAGCAGCTGGCCATTGCA
GTCCTGTCCCTCACGCTGGGCACCTTCACGGTCCTGGAGAACCTCCTGGTGCTGTGCGTC
ATCCTCCACTCCCGCAGCCTCCGCTGCAGGCCTTCCTACCACTTCATCGGCAGCCTGGCG
GTGGCAGACCTCCTGGGGAGTGTCATTTTTGTCTACAGCTTCATTGACTTCCACGTGTTC
CACCGCAAAGATAGCCGCAACGTGTTTCTGTTCAAACTGGGTGGGGTCACGGCCTCCTTC
ACTGCCTCCGTGGGCAGCCTGTTCCTCACAGCCATCGACAGGTACATATCCATTCACAGG
CCCCTGGCCTATAAGAGGATTGTCACCAGGCCCAAGGCCGTGGTGGCGTTTTGCCTGATG
TGGACCATAGCCATTGTGATCGCCGTGCTGCCTCTCCTGGGCTGGAACTGCGAGAAACTG
CAATCTGTTTGCTCAGACATTTTCCCACACATTGATGAAACCTACCTGATGTTCTGGATC
GGGGTCACCAGCGTACTGCTTCTGTTCATCGTGTATGCGTACATGTATATTCTCTGGAAG
GCTCACAGCCACGCCGTCCGCATGATTCAGCGTGGCACCCAGAAGAGCATCATCATCCAC
ACGTCTGAGGATGGGAAGGTACAGGTGACCCGGCCAGACCAAGCCCGCATGGACATTAGG
TTAGCCAAGACCCTGGTCCTGATCCTGGTGGTGTTGATCATCTGCTGGGGCCCTCTGCTT
GCAATCATGGTGTATGATGTCTTTGGGAAGATGAACAAGCTCATTAAGACGGTGTTTGCA
TTCTGCAGTATGCTCTGCCTGCTGAACTCCACCGTGAACCCCATCATCTATGCTCTGAGG
AGTAAGGACCTGCGACACGCTTTCCGGAGCATGTTTCCCTCTTGTGAAGGCACTGCGCAG
CCTCTGGATAACAGCATGGGGGACTCGGACTGCCTGCACAAACACGCAAACAATGCAGCC
AGTGTTCACAGGGCCGCAGAAAGCTGCATCAAGAGCACGGTCAAGATTGCCAAGGTAACC
ATGTCTGTGTCCACAGACACGTCTGCCGAGGCTCTGTGA
Protein Properties
Number of Residues 472
Molecular Weight 52857.4
Theoretical pI 8.25
Pfam Domain Function
Signals
  • ["None"]
Transmembrane Regions
  • ["117-142", "155-175", "188-212", "233-255", "274-299", "345-365", "378-399"]
Protein Sequence
>Cannabinoid receptor 1
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
GenBank ID Protein 29915
UniProtKB/Swiss-Prot ID P21554
UniProtKB/Swiss-Prot Entry Name CNR1_HUMAN
PDB IDs Not Available
GenBank Gene ID X54937
GeneCard ID CNR1
GenAtlas ID CNR1
HGNC ID HGNC:2159
References
General References Not Available