Identification
HMDB Protein ID CDBP04691
Secondary Accession Numbers Not Available
Name 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Description Not Available
Synonyms
  1. ARD
  2. Aci-reductone dioxygenase
  3. MTCBP-1
  4. Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
  5. SIPL
  6. Submergence-induced protein 2 homolog
  7. Acireductone dioxygenase (Fe(2+)-requiring)
  8. Submergence-induced protein-like factor
  9. Fe-ARD
  10. Sip-L
Gene Name ADI1
Protein Type Enzyme
Biological Properties
General Function Involved in metal ion binding
Specific Function Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line.
GO Classification
Biological Process
L-methionine salvage from methylthioadenosine
polyamine metabolic process
Cellular Component
cytosol
plasma membrane
Golgi apparatus
nucleus
Function
catalytic activity
dioxygenase activity
oxidoreductase activity
ion binding
cation binding
metal ion binding
binding
Molecular Function
metal ion binding
acireductone dioxygenase [iron(II)-requiring] activity
Process
cellular amino acid biosynthetic process
metabolic process
cellular metabolic process
amino acid salvage
l-methionine salvage from methylthioadenosine
oxidation reduction
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Cellular Location
  1. Cell membrane
  2. Nucleus
  3. Peripheral membrane protein
  4. Cytoplasmic side
Pathways
Gene Properties
Chromosome Location 2
Locus 2p25.3
SNPs ADI1
Gene Sequence
>540 bp
ATGGTGCAGGCCTGGTATATGGACGACGCCCCGGGCGACCCGCGGCAACCCCACCGCCCC
GACCCCGGCCGCCCAGTGGGCCTGGAGCAGCTGCGGCGGCTCGGGGTGCTCTACTGGAAG
CTGGATGCTGACAAATATGAGAATGATCCAGAATTAGAAAAGATCCGAAGAGAGAGGAAC
TACTCCTGGATGGACATCATAACCATATGCAAAGATAAACTACCAAATTATGAAGAAAAG
ATTAAGATGTTCTACGAGGAGCATTTGCACTTGGACGATGAGATCCGCTACATCCTGGAT
GGCAGTGGGTACTTCGACGTGAGGGACAAGGAGGACCAGTGGATCCGGATCTTCATGGAG
AAGGGAGACATGGTGACGCTCCCCGCGGGGATCTATCACCGCTTCACGGTGGACGAGAAG
AACTACACGAAGGCCATGCGGCTGTTTGTGGGAGAACCGGTGTGGACAGCGTACAACCGG
CCCGCTGACCATTTTGAAGCCCGCGGGCAGTACGTGAAATTTCTGGCACAGACCGCCTAG
Protein Properties
Number of Residues 179
Molecular Weight 21498.23
Theoretical pI 5.677
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERN
YSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFME
KGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BV57
UniProtKB/Swiss-Prot Entry Name MTND_HUMAN
PDB IDs Not Available
GenBank Gene ID AB158319
GeneCard ID ADI1
GenAtlas ID ADI1
HGNC ID HGNC:30576
References
General References Not Available