Showing Protein Putative uncharacterized protein PRPS2 (CDBP04683)
| Identification | |
|---|---|
| HMDB Protein ID | CDBP04683 |
| Secondary Accession Numbers | Not Available |
| Name | Putative uncharacterized protein PRPS2 |
| Description | Not Available |
| Synonyms | Not Available |
| Gene Name | PRPS2 |
| Protein Type | Enzyme |
| Biological Properties | |
| General Function | Nucleotide transport and metabolism |
| Specific Function | Not Available |
| GO Classification | Not Available |
| Cellular Location | Not Available |
| Pathways | Not Available |
| Gene Properties | |
| Chromosome Location | Not Available |
| Locus | Not Available |
| SNPs | PRPS2 |
| Gene Sequence | Not Available |
| Protein Properties | |
| Number of Residues | 147 |
| Molecular Weight | 16130.4 |
| Theoretical pI | 7.02 |
| Pfam Domain Function | Not Available |
| Signals |
|
| Transmembrane Regions |
|
| Protein Sequence |
>Putative uncharacterized protein PRPS2 MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGC GEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAG ADHIITMDLHASQIQGKHCRVEELYHC |
| External Links | |
| GenBank ID Protein | Not Available |
| UniProtKB/Swiss-Prot ID | A6NMS2 |
| UniProtKB/Swiss-Prot Entry Name | A6NMS2_HUMAN |
| PDB IDs | Not Available |
| GenBank Gene ID | Not Available |
| GeneCard ID | PRPS2 |
| GenAtlas ID | PRPS2 |
| HGNC ID | HGNC:9465 |
| References | |
| General References | Not Available |