Showing Protein Protein S100-B (CDBP03191)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | CDBP03191 | ||||||
Secondary Accession Numbers | Not Available | ||||||
Name | Protein S100-B | ||||||
Description | Not Available | ||||||
Synonyms |
|
||||||
Gene Name | S100B | ||||||
Protein Type | Metal Binding | ||||||
Biological Properties | |||||||
General Function | Involved in calcium ion binding | ||||||
Specific Function | Weakly binds calcium but binds zinc very tightly- distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling | ||||||
GO Classification |
|
||||||
Cellular Location |
|
||||||
Pathways | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | Chromosome:2 | ||||||
Locus | 21q22.3 | ||||||
SNPs | S100B | ||||||
Gene Sequence |
>279 bp ATGTCTGAGCTGGAGAAGGCCATGGTGGCCCTCATCGACGTTTTCCACCAATATTCTGGA AGGGAGGGAGACAAGCACAAGCTGAAGAAATCCGAACTGAAGGAGCTCATCAACAATGAG CTTTCCCATTTCTTAGAGGAAATCAAAGAGCAGGAGGTTGTGGACAAAGTCATGGAAACA CTGGACAATGATGGAGACGGCGAATGTGACTTCCAGGAATTCATGGCCTTTGTTGCCATG GTTACTACTGCCTGCCACGAGTTCTTTGAACATGAGTGA |
||||||
Protein Properties | |||||||
Number of Residues | 92 | ||||||
Molecular Weight | 10713.0 | ||||||
Theoretical pI | 4.25 | ||||||
Pfam Domain Function |
|
||||||
Signals |
|
||||||
Transmembrane Regions |
|
||||||
Protein Sequence |
>Protein S100-B MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
||||||
External Links | |||||||
GenBank ID Protein | 5454034 | ||||||
UniProtKB/Swiss-Prot ID | P04271 | ||||||
UniProtKB/Swiss-Prot Entry Name | S100B_HUMAN | ||||||
PDB IDs | |||||||
GenBank Gene ID | NM_006272.2 | ||||||
GeneCard ID | S100B | ||||||
GenAtlas ID | S100B | ||||||
HGNC ID | HGNC:10500 | ||||||
References | |||||||
General References | Not Available |