Identification
HMDB Protein ID CDBP02504
Secondary Accession Numbers Not Available
Name Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
Description Not Available
Synonyms
  1. Methenyltetrahydrofolate cyclohydrolase
  2. NAD-dependent methylenetetrahydrofolate dehydrogenase
  3. NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein
  4. MTHFD2-like
Gene Name MTHFD2L
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
GO Classification
Biological Process
purine nucleotide biosynthetic process
methionine biosynthetic process
folic acid-containing compound biosynthetic process
histidine biosynthetic process
tetrahydrofolate interconversion
one-carbon metabolic process
Cellular Component
mitochondrion
mitochondrial inner membrane
Function
binding
catalytic activity
Molecular Function
nucleotide binding
methylenetetrahydrofolate dehydrogenase (NAD+) activity
methenyltetrahydrofolate cyclohydrolase activity
methylenetetrahydrofolate dehydrogenase (NADP+) activity
Process
metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
cellular metabolic process
folic acid and derivative biosynthetic process
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 4
Locus 4q13.3
SNPs MTHFD2L
Gene Sequence Not Available
Protein Properties
Number of Residues 289
Molecular Weight 37315.11
Theoretical pI 9.33
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
MAKHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILK
PKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGR
LCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGG
DATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVT
GKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY
GenBank ID Protein 222418558
UniProtKB/Swiss-Prot ID Q9H903
UniProtKB/Swiss-Prot Entry Name MTD2L_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID MTHFD2L
GenAtlas ID MTHFD2L
HGNC ID HGNC:31865
References
General References Not Available