Identification
HMDB Protein ID CDBP02421
Secondary Accession Numbers Not Available
Name 1-acyl-sn-glycerol-3-phosphate acyltransferase delta
Description Not Available
Synonyms
  1. 1-AGP acyltransferase 4
  2. 1-AGPAT 4
  3. 1-acylglycerol-3-phosphate O-acyltransferase 4
  4. LPAAT-delta
  5. Lysophosphatidic acid acyltransferase delta
Gene Name AGPAT4
Protein Type Enzyme
Biological Properties
General Function Involved in acyltransferase activity
Specific Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (By similarity).
GO Classification
Biological Process
small molecule metabolic process
CDP-diacylglycerol biosynthetic process
phosphatidic acid biosynthetic process
triglyceride biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
acyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Molecular Function
1-acylglycerol-3-phosphate O-acyltransferase activity
Process
metabolic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Pathways
Gene Properties
Chromosome Location 6
Locus 6q26
SNPs AGPAT4
Gene Sequence
>1137 bp
ATGGACCTCGCGGGACTGCTGAAGTCTCAGTTCCTGTGCCACCTGGTCTTCTGCTACGTC
TTTATTGCCTCAGGGCTAATCATCAACACCATTCAGCTCTTCACTCTCCTCCTCTGGCCC
ATTAACAAGCAGCTCTTCCGGAAGATCAACTGCAGACTGTCCTATTGCATCTCAAGCCAG
CTGGTGATGCTGCTGGAGTGGTGGTCGGGCACGGAATGCACCATCTTCACGGACCCGCGC
GCCTACCTCAAGTATGGGAAGGAAAATGCCATCGTGGTTCTCAACCACAAGTTTGAAATT
GACTTTCTGTGTGGCTGGAGCCTGTCCGAACGCTTTGGGCTGTTAGGGGGCTCCAAGGTC
CTGGCCAAGAAAGAGCTGGCCTATGTCCCAATTATCGGCTGGATGTGGTACTTCACCGAG
ATGGTCTTCTGTTCGCGCAAGTGGGAGCAGGATCGCAAGACGGTTGCCACCAGTTTGCAG
CACCTCCGGGACTACCCCGAGAAGTATTTTTTCCTGATTCACTGTGAGGGCACACGGTTC
ACGGAGAAGAAGCATGAGATCAGCATGCAGGTGGCCCGGGCCAAGGGGCTGCCTCGCCTC
AAGCATCACCTGTTGCCACGAACCAAGGGCTTCGCCATCACCGTGAGGAGCTTGAGAAAT
GTAGTTTCAGCTGTATATGACTGTACACTCAATTTCAGAAATAATGAAAATCCAACACTG
CTGGGAGTCCTAAACGGAAAGAAATACCATGCAGATTTGTATGTTAGGAGGATCCCACTG
GAAGACATCCCTGAAGACGATGACGAGTGCTCGGCCTGGCTGCACAAGCTCTACCAGGAG
AAGGATGCCTTTCAGGAGGAGTACTACAGGACGGGCACCTTCCCAGAGACGCCCATGGTG
CCCCCCCGGCGGCCCTGGACCCTCGTGAACTGGCTGTTTTGGGCCTCGCTGGTGCTCTAC
CCTTTCTTCCAGTTCCTGGTCAGCATGATCAGGAGCGGGTCTTCCCTGACGCTGGCCAGC
TTCATCCTCGTCTTCTTTGTGGCCTCCGTGGGAGTTCGATGGATGATTGGTGTGACGGAA
ATTGACAAGGGCTCTGCCTACGGCAACTCTGACAGCAAGCAGAAACTGAATGACTGA
Protein Properties
Number of Residues 378
Molecular Weight 44020.935
Theoretical pI 8.717
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-acyl-sn-glycerol-3-phosphate acyltransferase delta
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQ
LVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV
LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF
TEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL
LGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV
PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTE
IDKGSAYGNSDSKQKLND
GenBank ID Protein 8886005
UniProtKB/Swiss-Prot ID Q9NRZ5
UniProtKB/Swiss-Prot Entry Name PLCD_HUMAN
PDB IDs Not Available
GenBank Gene ID AF156776
GeneCard ID AGPAT4
GenAtlas ID AGPAT4
HGNC ID HGNC:20885
References
General References Not Available