Identification
HMDB Protein ID CDBP02416
Secondary Accession Numbers Not Available
Name 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
Description Not Available
Synonyms
  1. PLC-L3
  2. PLC-eta-1
  3. Phosphoinositide phospholipase C-eta-1
  4. Phospholipase C-eta-1
  5. Phospholipase C-like protein 3
Gene Name PLCH1
Protein Type Enzyme
Biological Properties
General Function Involved in calcium ion binding
Specific Function The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes.
GO Classification
Biological Process
lipid catabolic process
phosphatidylinositol-mediated signaling
Cellular Component
cytosol
cytoplasm
nuclear membrane
Function
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
phospholipase c activity
phosphoinositide phospholipase c activity
calcium ion binding
lipase activity
phospholipase activity
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
Molecular Function
phospholipid binding
phosphatidylinositol phospholipase C activity
calcium-dependent phospholipase C activity
signal transducer activity
calcium ion binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
metabolic process
primary metabolic process
Cellular Location
  1. Cytoplasm
  2. Membrane
Pathways
Gene Properties
Chromosome Location 3
Locus 3q25.31
SNPs PLCH1
Gene Sequence
>5082 bp
ATGGCAGACCTTGAAGTGTATAAAAACTTAAGTCCAGAAAAAGTTGAAAGATGCATGAGT
GTGATGCAGTCCGGGACACAGATGATCAAGCTGAAACGTGGAACCAAAGGGCTTGTCCGC
CTCTTTTACCTGGATGAGCACCGGACACGCCTCCGATGGCGACCCTCTAGGAAGAGTGAG
AAGGCAAAAATACTTATTGATTCCATTTACAAAGTGACTGAGGGCCGGCAGTCTGAAATA
TTCCACAGACAAGCTGAGGGGAACTTCGACCCCAGCTGCTGCTTCACCATCTACCATGGC
AACCACATGGAGTCCCTGGACCTCATCACCTCCAACCCCGAGGAGGCCCGCACCTGGATC
ACAGGCCTCAAGTACCTGATGGCTGGCATCAGTGATGAAGACTCCCTTGCCAAAAGGCAG
AGGACCCATGACCAATGGGTGAAGCAGACCTTTGAGGAAGCTGATAAGAATGGTGACGGC
TTGCTGAATATTGAAGAGATACATCAGCTGATGCATAAACTGAATGTTAATCTGCCCCGA
AGAAAAGTCAGACAAATGTTTCAGGAAGCCGACACAGATGAGAATCAGGGAACTTTGACA
TTTGAAGAGTTCTGTGTTTTTTACAAAATGATGTCTTTGAGACGAGACCTTTATTTGTTA
CTTTTGAGCTACAGTGACAAGAAAGATCACCTAACTGTGGAAGAACTGGCTCAGTTTTTG
AAGGTGGAGCAAAAGATGAATAATGTGACAACGGACTATTGTCTTGACATCATAAAGAAG
TTTGAAGTTTCAGAAGAAAATAAGGTGAAAAATGTTCTTGGCATAGAAGGCTTCACGAAC
TTCATGCGTAGTCCTGCCTGTGACATATTTAACCCATTGCACCATGAAGTGTACCAAGAC
ATGGATCAGCCCCTCTGCAACTACTACATTGCTTCCTCTCACAATACATACCTGACTGGA
GACCAGCTCCTTTCTCAGTCCAAAGTGGATATGTATGCACGGGTGCTGCAAGAGGGCTGT
CGCTGTGTGGAAGTTGACTGTTGGGATGGCCCAGATGGAGAGCCAGTAGTACATCATGGT
TACACTCTCACTTCAAAAATTCTCTTCAGAGATGTTGTGGAGACCATCAACAAGCATGCC
TTTGTGAAGAATGAGTTTCCTGTTATATTGTCTATCGAGAATCACTGCAGTATCCAGCAG
CAAAGGAAGATTGCTCAGTACCTGAAAGGAATATTCGGAGACAAACTGGACCTGTCATCT
GTTGATACAGGGGAGTGCAAGCAGCTTCCAAGCCCTCAAAGTTTGAAAGGCAAAATTCTA
GTGAAGGGTAAGAAGTTGCCTTATCACCTTGGGGATGATGCAGAGGAAGGGGAAGTTTCT
GATGAGGACAGTGCAGATGAAATTGAAGACGAGTGCAAATTCAAGCTCCATTATAGTAAT
GGGACCACTGAGCATCAGGTGGAATCTTTCATAAGGAAAAAACTGGAGTCACTGTTAAAA
GAATCTCAAATTCGAGATAAAGAAGATCCTGATAGTTTCACAGTGCGGGCACTACTGAAG
GCCACGCATGAAGGCTTAAATGCACACCTGAAGCAGAGTCCAGATGTAAAGGAAAGTGGA
AAGAAATCACATGGACGATCCCTCATGACCAACTTTGGAAAACATAAGAAAACTACAAAA
TCACGGTCTAAATCTTACAGTACTGATGATGAGGAAGACACACAGCAGAGTACTGGCAAG
GAGGGTGGCCAGCTGTACAGATTGGGTCGCCGAAGGAAAACCATGAAGCTCTGCCGAGAA
CTCTCTGATTTGGTTGTGTACACAAACTCCGTGGCCGCTCAGGACATTGTGGATGACGGA
ACCACAGGAAATGTGTTATCATTCAGTGAAACAAGAGCACATCAGGTTGTTCAGCAAAAA
TCAGAGCAGTTCATGATTTATAATCAAAAGCAACTCACGAGGATTTACCCCTCTGCCTAC
CGCATTGATTCCAGTAACTTCAACCCTCTCCCCTACTGGAACGCAGGCTGCCAGCTAGTG
GCACTGAATTATCAATCTGAAGGACGAATGATGCAGTTAAACCGAGCCAAATTCAAGGCA
AATGGCAATTGTGGCTATGTCCTCAAACCCCAGCAAATGTGCAAAGGTACTTTCAACCCT
TTCTCTGGTGACCCTCTTCCTGCCAACCCCAAAAAGCAGCTCATCCTGAAAGTTATCAGT
GGACAGCAACTCCCCAAACCTCCAGACTCCATGTTTGGAGATCGAGGCGAGATCATTGAC
CCTTTTGTTGAAGTTGAAATTATTGGATTGCCAGTAGATTGTTGTAAAGATCAAACCCGT
GTGGTAGATGACAATGGATTTAACCCTGTGTGGGAAGAAACACTGACATTTACAGTACAC
ATGCCAGAAATAGCTTTGGTTCGGTTCCTTGTGTGGGATCACGATCCCATTGGACGAGAC
TTTGTTGGACAAAGAACTGTGACCTTCAGCAGCTTAGTGCCTGGCTACCGGCATGTCTAT
TTGGAAGGACTGACAGAAGCATCCATATTTGTACACATAACCATCAATGAAATCTATGGA
AAGTGGAGCCCTTTAATACTCAACCCCAGTTATACTATATTGCACTTTCTAGGAGCTACA
AAGAACAGACAACTCCAGGGTCTGAAGGGACTGTTCAATAAGAATCCTAGGCACAGTTCT
TCAGAAAACAATTCCCATTATGTACGGAAGCGATCCATTGGAGATAGAATTCTGCGACGC
ACAGCTAGCGCCCCAGCCAAAGGCAGGAAAAAGAGCAAAATGGGCTTCCAAGAAATGGTG
GAGATAAAGGATTCTGTGTCCGAGGCCACAAGAGATCAAGATGGCGTGCTGAGGAGGACC
ACACGCAGTTTGCAAGCACGCCCTGTCTCTATGCCTGTTGACAGAAACCTTCTGGGAGCT
TTGTCGCTGCCTGTATCTGAAACAGCAAAAGACATTGAAGGAAAAGAAAACTCTCTAGCA
GAAGATAAAGATGGCAGAAGAAAAGGGAAAGCAAGTATAAAAGATCCACATTTTCTAAAT
TTCAACAAAAAGTTATCATCCTCCTCCAGTGCTCTGCTCCACAAAGATACCAGCCAAGGG
GACACCATTGTATCTACTGCCCACATGTCAGTCACAGGAGAACAGCTGGGCATGTCAAGT
CCTAGGGGTGGGAGAACCACATCAAATGCCACAAGCAATTGCCAGGAAAACCCCTGTCCC
AGCAAGTCTCTCTCCCCAAAGCAGCATTTGGCTCCCGATCCTGTAGTTAACCCCACACAA
GATCTGCATGGTGTGAAAATCAAGGAAAAGGGTAATCCTGAGGACTTTGTGGAAGGGAAA
AGCATCTTGTCAGGAAGCGTCCTTTCTCATAGCAACCTAGAAATTAAGAACCTGGAAGGT
AATAGGGGTAAGGGCCGAGCTGCAACATCCTTTTCTTTGTCAGACGTCTCCATGCTCTGT
TCTGACATACCTGACCTACATTCAACTGCAATTCTGCAGGAGAGTGTAATTTCCCATCTT
ATTGACAATGTCACTTTAACAAATGAGAATGAGCCGGGCAGTTCCATCTCAGCCCTGATT
GGCCAGTTTGATGAGACCAACAATCAGGCTCTCACAGTTGTTTCTCATCTTCATAATACC
AGTGTGATGTCAGGCCATTGTCCCTTGCCTAGCCTGGGCCTAAAAATGCCCATCAAGCAT
GGTTTTTGCAAGGGAAAATCCAAGTCTTCCTTCCTGTGCTCATCTCCGGAGCTGATAGCA
CTCTCGAGTTCTGAGACCACCAAACATGCAACGAACACAGTTTATGAAACTACCTGCACT
CCCATCTCTAAAACCAAACCAGATGATGACCTTTCTAGTAAGGCCAAGACAGCGGCCTTA
GAAAGCAACCTGCCTGGATCCCCTAATACTTCTCGTGGCTGGTTACCAAAAAGTCCTACC
AAGGGAGAAGACTGGGAAACACTGAAGAGCTGCAGCCCTGCCTCTTCCCCTGATTTGACC
CTGGAGGATGTAATAGCTGATCCCACTCTCTGTTTCAATTCTGGGGAGAGCAGCCTTGTG
GAAATTGATGGAGAATCAGAAAATCTTTCTCTAACAACCTGTGAATATAGGAGAGAGGGC
ACAAGTCAACTTGCTTCTCCTTTAAAACTCAAGTACAATCAGGGTGTGGTAGAACACTTT
CAAAGAGGTTTGAGAAACGGCTACTGTAAAGAGACCCTCCGCCCTTCTGTCCCTGAAATA
TTCAACAATATTCAAGATGTCAAAACTCAAAGTATTTCTTATCTAGCCTATCAGGGTGCT
GGCTTTGTGCATAATCATTTCTCAGATTCAGATGCAAAAATGTTCCAGACCTGTGTGCCC
CAGCAATCTAGTGCTCAAGATATGCATGTCCCTGTACCCAAGCAGTTGGCACATCTTCCT
TTGCCTGCTCTGAAACTGCCTAGTCCTTGCAAATCCAAAAGTCTGGGGGACTTAACATCA
GAGGACATTGCCTGCAATTTTGAGAGCAAGTACCAGTGTATTAGTAAGAGTTTTGTTACA
ACTGGCATTAGAGACAAGAAGGGCGTGACTGTGAAGACAAAGTCGTTAGAGCCTATAGAT
GCCCTGACCGAGCAGCTTCGGAAGCTTGTGTCCTTTGACCAGGAAGACAACTGCCAAGTG
CTATATTCAAAGCAGGATGCCAATCAGCTCCCCCGGGCACTGGTCAGGAAGTTGTCATCC
AGAAGTCAGAGCAGAGTGCGCAATATTGCTAGTCGTGCCAAGGAGAAACAGGAAGCCAAC
AAGCAGAAAGTTCCAAACCCCAGCAATGGGGCAGGAGTGGTTCTTAGAAACAAACCCTCA
GCACCCACCCCTGCAGTGAATCGCCACTCCACCGGCTCCTACATCGCAGGCTACCTGAAG
AACACGAAAGGGGGTGGCCTTGAAGGCCGGGGCATCCCAGAGGGGGCATGCACGGCTCTT
CACTATGGCCACGTTGACCAGTTTTGTTCAGATAATTCTGTTTTGCAGACTGAGCCAAGC
AGTGATGATAAACCAGAAATTTATTTTCTTTTGAGACTGTGA
Protein Properties
Number of Residues 1693
Molecular Weight 189221.52
Theoretical pI 7.743
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-1
MADLEVYKNLSPEKVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSE
KAKILIDSIYKVTEGRQSEIFHRQAEGNFDPSCCFTIYHGNHMESLDLITSNPEEARTWI
TGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPR
RKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKKDHLTVEELAQFL
KVEQKMNNVTTDYCLDIIKKFEVSEENKVKNVLGIEGFTNFMRSPACDIFNPLHHEVYQD
MDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHG
YTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFGDKLDLSS
VDTGECKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYSN
GTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLKATHEGLNAHLKQSPDVKESG
KKSHGRSLMTNFGKHKKTTKSRSKSYSTDDEEDTQQSTGKEGGQLYRLGRRRKTMKLCRE
LSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAY
RIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKANGNCGYVLKPQQMCKGTFNP
FSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTR
VVDDNGFNPVWEETLTFTVHMPEIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVY
LEGLTEASIFVHITINEIYGKWSPLILNPSYTILHFLGATKNRQLQGLKGLFNKNPRHSS
SENNSHYVRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEATRDQDGVLRRT
TRSLQARPVSMPVDRNLLGALSLPVSETAKDIEGKENSLAEDKDGRRKGKASIKDPHFLN
FNKKLSSSSSALLHKDTSQGDTIVSTAHMSVTGEQLGMSSPRGGRTTSNATSNCQENPCP
SKSLSPKQHLAPDPVVNPTQDLHGVKIKEKGNPEDFVEGKSILSGSVLSHSNLEIKNLEG
NRGKGRAATSFSLSDVSMLCSDIPDLHSTAILQESVISHLIDNVTLTNENEPGSSISALI
GQFDETNNQALTVVSHLHNTSVMSGHCPLPSLGLKMPIKHGFCKGKSKSSFLCSSPELIA
LSSSETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPT
KGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGESSLVEIDGESENLSLTTCEYRREG
TSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGA
GFVHNHFSDSDAKMFQTCVPQQSSAQDMHVPVPKQLAHLPLPALKLPSPCKSKSLGDLTS
EDIACNFESKYQCISKSFVTTGIRDKKGVTVKTKSLEPIDALTEQLRKLVSFDQEDNCQV
LYSKQDANQLPRALVRKLSSRSQSRVRNIASRAKEKQEANKQKVPNPSNGAGVVLRNKPS
APTPAVNRHSTGSYIAGYLKNTKGGGLEGRGIPEGACTALHYGHVDQFCSDNSVLQTEPS
SDDKPEIYFLLRL
GenBank ID Protein 195972871
UniProtKB/Swiss-Prot ID Q4KWH8
UniProtKB/Swiss-Prot Entry Name PLCH1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001130960.1
GeneCard ID PLCH1
GenAtlas ID PLCH1
HGNC ID HGNC:29185
References
General References Not Available