| Identification |
| HMDB Protein ID
| CDBP02323 |
| Secondary Accession Numbers
| Not Available |
| Name
| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 |
| Description
| Not Available |
| Synonyms
|
- DAD-1
- Defender against cell death 1
- Oligosaccharyl transferase subunit DAD1
|
| Gene Name
| DAD1 |
| Protein Type
| Enzyme |
| Biological Properties |
| General Function
| Involved in dolichyl-diphosphooligosaccharide-protein g |
| Specific Function
| Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis (By similarity).
|
| GO Classification
|
| Biological Process |
| apoptotic process |
| negative regulation of apoptotic process |
| response to drug |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| response to nutrient |
| blastocyst development |
| Cellular Component |
| oligosaccharyltransferase complex |
| integral to membrane |
| Molecular Function |
| transferase activity, transferring glycosyl groups |
|
| Cellular Location
|
- Membrane
- Multi-pass membrane protein (Potential)
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein glycosylation | Not Available | Not Available | | N-Glycan biosynthesis | Not Available |  | | Protein processing in endoplasmic reticulum | Not Available |  |
|
| Gene Properties |
| Chromosome Location
| 14 |
| Locus
| 14q11.2 |
| SNPs
| DAD1 |
| Gene Sequence
|
>342 bp
ATGTCGGCGTCGGTAGTGTCTGTCATTTCGCGGTTCTTAGAAGAGTACTTGAGCTCCACT
CCGCAGCGTCTGAAGTTGCTGGACGCGTACCTGCTGTATATACTGCTGACCGGGGCGCTG
CAGTTCGGTTACTGTCTCCTCGTGGGGACCTTCCCCTTCAACTCTTTTCTCTCGGGCTTC
ATCTCTTGTGTGGGGAGTTTCATCCTAGCGGTTTGCCTGAGAATACAGATCAACCCACAG
AACAAAGCGGATTTCCAAGGCATCTCCCCAGAGCGAGCCTTTGCTGATTTTCTCTTTGCC
AGCACCATCCTGCACCTTGTTGTCATGAACTTTGTTGGCTGA
|
| Protein Properties |
| Number of Residues
| 113 |
| Molecular Weight
| 12496.55 |
| Theoretical pI
| 7.076 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
|
| External Links |
| GenBank ID Protein
| 29501770 |
| UniProtKB/Swiss-Prot ID
| P61803 |
| UniProtKB/Swiss-Prot Entry Name
| DAD1_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AY259117 |
| GeneCard ID
| DAD1 |
| GenAtlas ID
| DAD1 |
| HGNC ID
| HGNC:2664 |
| References |
| General References
| Not Available |