Identification
HMDB Protein ID CDBP02291
Secondary Accession Numbers Not Available
Name Cytosolic 5'-nucleotidase 3
Description Not Available
Synonyms
  1. Cytosolic 5'-nucleotidase III
  2. P5'N-1
  3. P5N-1
  4. PN-I
  5. Pyrimidine 5'-nucleotidase 1
  6. Uridine 5'-monophosphate hydrolase 1
  7. cN-III
  8. p36
Gene Name NT5C3
Protein Type Enzyme
Biological Properties
General Function Involved in magnesium ion binding
Specific Function Can act both as nucleotidase and as phosphotransferase.
GO Classification
Biological Process
nucleotide metabolic process
adenosine metabolic process
pyrimidine nucleobase metabolic process
pyrimidine nucleoside catabolic process
Cellular Component
cytosol
endoplasmic reticulum
mitochondrion
Component
cell part
intracellular part
cytoplasm
Function
nucleotidase activity
5'-nucleotidase activity
magnesium ion binding
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
5'-nucleotidase activity
magnesium ion binding
2'-phosphotransferase activity
nucleotide binding
Cellular Location
  1. Isoform 2:Endoplasmic reticulum
Pathways
Gene Properties
Chromosome Location 7
Locus 7p14.3
SNPs NT5C3
Gene Sequence
>1011 bp
ATGAGGGCCCCGTCCATGGACCGCGCGGCCGTGGCGAGGGTGGGCGCGGTAGCGAGCGCC
AGCGTGTGCGCCCTGGTGGCGGGGGTGGTGCTGGCTCAGTACATATTCACCTTGAAGAGG
AAGACGGGGCGGAAGACCAAGATCATCGAGATGATGCCAGAATTCCAGAAAAGTTCAGTT
CGAATCAAGAACCCTACAAGAGTAGAAGAAATTATCTGTGGTCTTATCAAAGGAGGAGCT
GCCAAACTTCAGATAATAACGGACTTTGATATGACACTCAGTAGATTTTCATATAAAGGG
AAAAGATGCCCAACATGTCATAATATCATTGACAACTGTAAGCTGGTTACAGATGAATGT
AGAAAAAAGTTATTGCAACTAAAGGAAAAATATTACGCTATTGAAGTTGATCCTGTTCTT
ACTGTAGAAGAGAAGTACCCTTATATGGTGGAATGGTATACTAAATCACATGGTTTGCTT
GTTCAGCAAGCTTTACCAAAAGCTAAACTTAAAGAAATTGTGGCAGAATCTGACGTTATG
CTCAAAGAAGGATATGAGAATTTCTTTGATAAGCTCCAACAACATAGCATCCCCGTGTTC
ATATTTTCGGCTGGAATCGGCGATGTACTAGAGGAAGTTATTCGTCAAGCTGGTGTTTAT
CATCCCAATGTCAAAGTTGTGTCCAATTTTATGGATTTTGATGAAACTGGGGTGCTCAAA
GGATTTAAAGGAGAACTAATTCATGTATTTAACAAACATGATGGTGCCTTGAGGAATACA
GAATATTTCAATCAACTAAAAGACAATAGTAACATAATTCTTCTGGGAGACTCCCAAGGA
GACTTAAGAATGGCAGATGGAGTGGCCAATGTTGAGCACATTCTGAAAATTGGATATCTA
AATGATAGAGTGGATGAGCTTTTAGAAAAGTACATGGACTCTTATGATATTGTTTTAGTA
CAAGATGAATCATTAGAAGTAGCCAACTCTATTTTACAGAAGATTCTATAA
Protein Properties
Number of Residues 336
Molecular Weight 33914.91
Theoretical pI 5.854
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic 5'-nucleotidase 3
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
GenBank ID Protein 70608082
UniProtKB/Swiss-Prot ID Q9H0P0
UniProtKB/Swiss-Prot Entry Name 5NT3_HUMAN
PDB IDs
GenBank Gene ID NM_001002010.1
GeneCard ID NT5C3
GenAtlas ID NT5C3
HGNC ID HGNC:17820
References
General References Not Available