| Identification |
|---|
| HMDB Protein ID
| CDBP02248 |
| Secondary Accession Numbers
| Not Available |
| Name
| Cytochrome b-c1 complex subunit 10 |
| Description
| Not Available |
| Synonyms
|
- Complex III subunit 10
- Complex III subunit XI
- Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
|
| Gene Name
| UQCR11 |
| Protein Type
| Transporter |
| Biological Properties |
|---|
| General Function
| Involved in ubiquinol-cytochrome-c reductase activity |
| Specific Function
| This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor |
| GO Classification
|
| Component |
| membrane |
| cell part |
| organelle membrane |
| mitochondrial membrane |
| Function |
| ubiquinol-cytochrome-c reductase activity |
| transporter activity |
| electron carrier activity |
| transmembrane transporter activity |
| substrate-specific transmembrane transporter activity |
| ion transmembrane transporter activity |
| cation transmembrane transporter activity |
| inorganic cation transmembrane transporter activity |
| monovalent inorganic cation transmembrane transporter activity |
| hydrogen ion transmembrane transporter activity |
| Process |
| metabolic process |
| generation of precursor metabolites and energy |
| electron transport chain |
| respiratory electron transport chain |
| cellular metabolic process |
| mitochondrial electron transport, ubiquinol to cytochrome c |
|
| Cellular Location
|
- Mitochondrion inner membrane
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 19p13.3 |
| SNPs
| UQCR11 |
| Gene Sequence
|
>171 bp
ATGGTGACCCGGTTCCTGGGCCCACGCTACCGGGAGCTGGTCAAGAACTGGGTCCCGACG
GCCTACACATGGGGCGCTGTGGGCGCCGTGGGGCTGGTGTGGGCCACCGATTGGCGGCTG
ATCCTGGACTGGGTACCTTACATCAATGGCAAGTTTAAGAAGGATAATTAA
|
| Protein Properties |
|---|
| Number of Residues
| 56 |
| Molecular Weight
| 6569.7 |
| Theoretical pI
| 10.35 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Cytochrome b-c1 complex subunit 10
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O14957 |
| UniProtKB/Swiss-Prot Entry Name
| QCR10_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| D55636 |
| GeneCard ID
| UQCR11 |
| GenAtlas ID
| UQCR11 |
| HGNC ID
| HGNC:30862 |
| References |
|---|
| General References
| Not Available |