Identification
HMDB Protein ID CDBP02218
Secondary Accession Numbers Not Available
Name Glycine cleavage system H protein, mitochondrial
Description Not Available
Synonyms Not Available
Gene Name GCSH
Protein Type Enzyme
Biological Properties
General Function Involved in glycine catabolic process
Specific Function The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.
GO Classification
Biological Process
glycine catabolic process
glycine decarboxylation via glycine cleavage system
Cellular Component
mitochondrion
glycine cleavage complex
Component
mitochondrion
macromolecular complex
protein complex
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
glycine cleavage complex
Molecular Function
aminomethyltransferase activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
metabolic process
cellular metabolic process
glycine decarboxylation via glycine cleavage system
serine family amino acid metabolic process
glycine metabolic process
glycine catabolic process
Cellular Location
  1. Mitochondrion
Pathways
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GCSH
Gene Sequence
>522 bp
ATGGCGCTGCGAGTGGTGCGGAGCGTGCGGGCCCTGCTCTGCACCCTGCGCGCGGTCCCG
TTACCCGCCGCGCCCTGCCCGCCGAGGCCCTGGCAGCTGGGGGTGGGCGCCGTCCGTACG
CTGCGCACTGGACCCGCTCTGCTCTCGGTGCGTAAATTCACAGAGAAACACGAATGGGTA
ACAACAGAAAATGGCATTGGAACAGTGGGAATCAGCAATTTTGCACAGGAAGCGTTGGGA
GATGTTGTTTATTGTAGTCTCCCTGAAGTTGGGACAAAATTGAACAAACAAGATGAGTTT
GGTGCTTTGGAAAGTGTGAAAGCTGCTAGTGAACTCTATTCTCCTTTATCAGGAGAAGTA
ACTGAAATTAATGAAGCTCTTGCAGAAAATCCAGGACTTGTAAACAAATCTTGTTATGAA
GATGGTTGGCTGATCAAGATGACACTGAGTAACCCTTCAGAACTAGATGAACTTATGAGT
GAAGAAGCATATGAGAAATACATAAAATCTATTGAGGAGTGA
Protein Properties
Number of Residues 173
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycine cleavage system H protein, mitochondrial
MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWV
TTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEV
TEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P23434
UniProtKB/Swiss-Prot Entry Name GCSH_HUMAN
PDB IDs Not Available
GenBank Gene ID M69175
GeneCard ID GCSH
GenAtlas ID GCSH
HGNC ID HGNC:4208
References
General References Not Available