| Identification |
|---|
| HMDB Protein ID
| CDBP01932 |
| Secondary Accession Numbers
| Not Available |
| Name
| Eukaryotic translation initiation factor 5A-1 |
| Description
| Not Available |
| Synonyms
|
- Eukaryotic initiation factor 5A isoform 1
- Rev-binding factor
- eIF-4D
- eIF-5A
- eIF-5A-1
- eIF-5A1
|
| Gene Name
| EIF5A |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in RNA binding |
| Specific Function
| mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of TP53/p53 and TP53/p53-dependent apoptosis. Regulates also TNF- alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts |
| GO Classification
|
| Function |
| ribonucleoprotein binding |
| ribosome binding |
| rna binding |
| binding |
| nucleic acid binding |
| translation factor activity, nucleic acid binding |
| translation elongation factor activity |
| Process |
| peptidyl-lysine modification to hypusine |
| regulation of translational termination |
| positive regulation of translational termination |
| regulation of translational elongation |
| metabolic process |
| positive regulation of translational elongation |
| macromolecule metabolic process |
| translational frameshifting |
| posttranscriptional regulation of gene expression |
| regulation of translation |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of macromolecule metabolic process |
| regulation of gene expression |
| macromolecule modification |
| protein modification process |
| peptidyl-amino acid modification |
| peptidyl-lysine modification |
|
| Cellular Location
|
- Nucleus
- Nucleus
- Cytoplasm
- Peripheral membrane protein
- Endoplasmic reticulum membrane
- Cytoplasmic side
- nuclear pore complex
|
| Pathways
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 17p13-p12 |
| SNPs
| EIF5A |
| Gene Sequence
|
>465 bp
ATGGCAGATGACTTGGACTTCGAGACAGGAGATGCAGGGGCCTCAGCCACCTTCCCAATG
CAGTGCTCAGCATTACGTAAGAATGGCTTTGTGGTGCTCAAAGGCCGGCCATGTAAGATC
GTCGAGATGTCTACTTCGAAGACTGGCAAGCACGGCCACGCCAAGGTCCATCTGGTTGGT
ATTGACATCTTTACTGGGAAGAAATATGAAGATATCTGCCCGTCAACTCATAATATGGAT
GTCCCCAACATCAAAAGGAATGACTTCCAGCTGATTGGCATCCAGGATGGGTACCTATCA
CTGCTCCAGGACAGCGGGGAGGTACGAGAGGACCTTCGTCTCCCTGAGGGAGACCTTGGC
AAGGAGATTGAGCAGAAGTACGACTGTGGAGAAGAGATCCTGATCACGGTGCTGTCTGCC
ATGACAGAGGAGGCAGCTGTTGCAATCAAGGCCATGGCAAAATAA
|
| Protein Properties |
|---|
| Number of Residues
| 154 |
| Molecular Weight
| 16832.1 |
| Theoretical pI
| 4.86 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Eukaryotic translation initiation factor 5A-1
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
|
| External Links |
|---|
| GenBank ID Protein
| 158258667 |
| UniProtKB/Swiss-Prot ID
| P63241 |
| UniProtKB/Swiss-Prot Entry Name
| IF5A1_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AK292615 |
| GeneCard ID
| EIF5A |
| GenAtlas ID
| EIF5A |
| HGNC ID
| HGNC:3300 |
| References |
|---|
| General References
| Not Available |