Identification
HMDB Protein ID CDBP01469
Secondary Accession Numbers Not Available
Name 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
Description Not Available
Synonyms
  1. 1-AGP acyltransferase 1
  2. 1-AGPAT 1
  3. 1-acylglycerol-3-phosphate O-acyltransferase 1
  4. LPAAT-alpha
  5. Lysophosphatidic acid acyltransferase alpha
  6. Protein G15
Gene Name AGPAT1
Protein Type Enzyme
Biological Properties
General Function Involved in acyltransferase activity
Specific Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
GO Classification
Biological Process
small molecule metabolic process
CDP-diacylglycerol biosynthetic process
positive regulation of cytokine production
positive regulation of cytokine-mediated signaling pathway
phosphatidic acid biosynthetic process
energy reserve metabolic process
positive regulation of cellular metabolic process
triglyceride biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
membrane
cell part
cell
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acylglycerol o-acyltransferase activity
1-acylglycerol-3-phosphate o-acyltransferase activity
transferase activity, transferring groups other than amino-acyl groups
o-acyltransferase activity
Molecular Function
1-acylglycerol-3-phosphate O-acyltransferase activity
Process
phospholipid metabolism
physiological process
metabolism
phospholipid biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthesis
metabolic process
cellular lipid metabolism
membrane lipid metabolism
primary metabolism
lipid metabolism
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Pathways
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs AGPAT1
Gene Sequence
>852 bp
ATGGATTTGTGGCCAGGGGCATGGATGCTGCTGCTGCTGCTCTTCCTGCTGCTGCTCTTC
CTGCTGCCCACCCTGTGGTTCTGCAGCCCCAGTGCCAAGTACTTCTTCAAGATGGCCTTC
TACAATGGCTGGATCCTCTTCCTGGCTGTGCTCGCCATCCCTGTGTGTGCCGTGCGAGGA
CGCAACGTCGAGAACATGAAGATCTTGCGTCTAATGCTGCTCCACATCAAATACCTGTAC
GGGATCCGAGTGGAGGTGCGAGGGGCTCACCACTTCCCTCCCTCGCAGCCCTATGTTGTT
GTCTCCAACCACCAGAGCTCTCTCGATCTGCTTGGGATGATGGAGGTACTGCCAGGCCGC
TGTGTGCCCATTGCCAAGCGCGAGCTACTGTGGGCTGGCTCTGCCGGGCTGGCCTGCTGG
CTGGCAGGAGTCATCTTCATCGACCGGAAGCGCACGGGGGATGCCATCAGTGTCATGTCT
GAGGTCGCCCAGACCCTGCTCACCCAGGACGTGAGGGTCTGGGTGTTTCCTGAGGGAACG
AGAAACCACAATGGCTCCATGCTGCCCTTCAAACGTGGCGCCTTCCATCTTGCAGTGCAG
GCCCAGGTTCCCATTGTCCCCATAGTCATGTCCTCCTACCAAGACTTCTACTGCAAGAAG
GAGCGTCGCTTCACCTCGGGACAATGTCAGGTGCGGGTGCTGCCCCCAGTGCCCACGGAA
GGGCTGACACCAGATGACGTCCCAGCTCTGGCTGACAGAGTCCGGCACTCCATGCTCACT
GTTTTCCGGGAAATCTCCACTGATGGCCGGGGTGGTGGTGACTATCTGAAGAAGCCTGGG
GGCGGTGGGTGA
Protein Properties
Number of Residues 283
Molecular Weight 31716.27
Theoretical pI 9.383
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRG
RNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGR
CVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGT
RNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTE
GLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
GenBank ID Protein 55961399
UniProtKB/Swiss-Prot ID Q99943
UniProtKB/Swiss-Prot Entry Name PLCA_HUMAN
PDB IDs Not Available
GenBank Gene ID AL662828
GeneCard ID AGPAT1
GenAtlas ID AGPAT1
HGNC ID HGNC:324
References
General References Not Available