Identification
HMDB Protein ID CDBP01467
Secondary Accession Numbers Not Available
Name 1-acyl-sn-glycerol-3-phosphate acyltransferase beta
Description Not Available
Synonyms
  1. 1-AGP acyltransferase 2
  2. 1-AGPAT 2
  3. 1-acylglycerol-3-phosphate O-acyltransferase 2
  4. LPAAT-beta
  5. Lysophosphatidic acid acyltransferase beta
Gene Name AGPAT2
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
GO Classification
Biological Process
small molecule metabolic process
CDP-diacylglycerol biosynthetic process
positive regulation of cytokine production
positive regulation of cytokine-mediated signaling pathway
phosphatidic acid biosynthetic process
triglyceride biosynthetic process
epidermis development
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acylglycerol o-acyltransferase activity
1-acylglycerol-3-phosphate o-acyltransferase activity
o-acyltransferase activity
Molecular Function
1-acylglycerol-3-phosphate O-acyltransferase activity
Process
metabolic process
phospholipid biosynthetic process
organophosphate metabolic process
phospholipid metabolic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Pathways
Gene Properties
Chromosome Location 9
Locus 9q34.3
SNPs AGPAT2
Gene Sequence
>837 bp
ATGGAGCTGTGGCCGTGTCTGGCCGCGGCGCTGCTGTTGCTGCTGCTGCTGGTGCAGCTG
AGCCGCGCGGCCGAGTTCTACGCCAAGGTCGCCCTGTACTGCGCGCTGTGCTTCACGGTG
TCCGCCGTGGCCTCGCTCGTCTGCCTGCTGCGCCACGGCGGCCGGACGGTGGAGAACATG
AGCATCATCGGCTGGTTCGTGCGAAGCTTCAAGTACTTTTACGGGCTCCGCTTCGAGGTG
CGGGACCCGCGCAGGCTGCAGGAGGCCCGTCCCTGTGTCATCGTCTCCAACCACCAGAGC
ATCCTGGACATGATGGGCCTCATGGAGGTCCTTCCGGAGCGCTGCGTGCAGATCGCCAAG
CGGGAGCTGCTCTTCCTGGGGCCCGTGGGCCTCATCATGTACCTCGGGGGCGTCTTCTTC
ATCAACCGGCAGCGCTCTAGCACTGCCATGACAGTGATGGCCGACCTGGGCGAGCGCATG
GTCAGGGAGAACCTCAAAGTGTGGATCTATCCCGAGGGTACTCGCAACGACAATGGGGAC
CTGCTGCCTTTTAAGAAGGGCGCCTTCTACCTGGCAGTCCAGGCACAGGTGCCCATCGTC
CCCGTGGTGTACTCTTCCTTCTCCTCCTTCTACAACACCAAGAAGAAGTTCTTCACTTCA
GGAACAGTCACAGTGCAGGTGCTGGAAGCCATCCCCACCAGCGGCCTCACTGCGGCGGAC
GTCCCTGCGCTCGTGGACACCTGCCACCGGGCCATGAGGACCACCTTCCTCCACATCTCC
AAGACCCCCCAGGAGAACGGGGCCACTGCGGGGTCTGGCGTGCAGCCGGCCCAGTAG
Protein Properties
Number of Residues 278
Molecular Weight 27278.915
Theoretical pI 8.913
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>1-acyl-sn-glycerol-3-phosphate acyltransferase beta
MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENM
SIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAK
RELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGD
LLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAAD
VPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ
GenBank ID Protein 2282590
UniProtKB/Swiss-Prot ID O15120
UniProtKB/Swiss-Prot Entry Name PLCB_HUMAN
PDB IDs Not Available
GenBank Gene ID AF000237
GeneCard ID AGPAT2
GenAtlas ID Not Available
HGNC ID HGNC:325
References
General References Not Available