Identification
HMDB Protein ID CDBP00776
Secondary Accession Numbers Not Available
Name Glutathione S-transferase omega-2
Description Not Available
Synonyms
  1. GSTO-2
  2. Glutathione S-transferase omega 2-2
  3. Glutathione-dependent dehydroascorbate reductase
  4. Monomethylarsonic acid reductase
  5. GSTO 2-2
  6. MMA(V) reductase
Gene Name GSTO2
Protein Type Enzyme
Biological Properties
General Function Involved in glutathione transferase activity
Specific Function Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA).
GO Classification
Biological Process
L-ascorbic acid metabolic process
xenobiotic metabolic process
cellular response to arsenic-containing substance
Cellular Component
cytosol
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
glutathione transferase activity
Molecular Function
glutathione transferase activity
glutathione dehydrogenase (ascorbate) activity
methylarsonate reductase activity
Process
metabolic process
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 10
Locus 10q25.1
SNPs GSTO2
Gene Sequence
>732 bp
ATGTCTGGGGATGCGACCAGGACCCTGGGGAAAGGAAGCCAGCCCCCAGGGCCAGTCCCG
GAGGGGCTGATCCGCATCTACAGCATGAGGTTCTGCCCCTATTCTCACAGGACCCGCCTC
GTCCTCAAGGCCAAAGACATCAGACATGAAGTGGTCAACATTAACCTGAGAAACAAGCCT
GAATGGTACTATACAAAGCACCCTTTTGGCCACATTCCTGTCCTGGAGACCAGCCAATGT
CAACTGATCTATGAATCTGTTATTGCTTGTGAGTACCTGGATGATGCTTATCCAGGAAGG
AAGCTGTTTCCATATGACCCTTATGAACGAGCTCGCCAAAAGATGTTATTGGAGCTATTT
TGTAAGGTCCCACATTTGACCAAGGAGTGCCTGGTAGCGTTGAGATGTGGGAGAGAATGC
ACTAATCTGAAGGCAGCCCTGCGTCAGGAATTCAGCAACCTGGAAGAGATTCTTGAGTAT
CAGAACACCACCTTCTTTGGTGGAACCTGTATATCCATGATTGATTACCTCCTCTGGCCC
TGGTTTGAGCGGCTGGATGTGTATGGGATACTGGACTGTGTGAGCCACACGCCAGCCCTG
CGGCTCTGGATATCAGCCATGAAGTGGGACCCCACAGTCTGTGCTCTTCTCATGGATAAG
AGCATTTTCCAGGGCTTCTTGAATCTCTATTTTCAGAACAACCCTAATGCCTTTGACTTT
GGGCTGTGCTGA
Protein Properties
Number of Residues 243
Molecular Weight 24399.09
Theoretical pI 7.633
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glutathione S-transferase omega-2
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H4Y5
UniProtKB/Swiss-Prot Entry Name GSTO2_HUMAN
PDB IDs
GenBank Gene ID AY350731
GeneCard ID GSTO2
GenAtlas ID GSTO2
HGNC ID HGNC:23064
References
General References Not Available