Identification
HMDB Protein ID CDBP00652
Secondary Accession Numbers Not Available
Name Aminomethyltransferase, mitochondrial
Description Not Available
Synonyms
  1. GCVT
  2. Glycine cleavage system T protein
Gene Name AMT
Protein Type Enzyme
Biological Properties
General Function Involved in aminomethyltransferase activity
Specific Function The glycine cleavage system catalyzes the degradation of glycine.
GO Classification
Biological Process
glycine catabolic process
Cellular Component
mitochondrion
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
aminomethyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
transaminase activity
aminomethyltransferase activity
Process
cellular metabolic process
serine family amino acid metabolic process
glycine metabolic process
glycine catabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
metabolic process
Cellular Location
  1. Mitochondrion
Pathways
Gene Properties
Chromosome Location 3
Locus 3p21.2-p21.1
SNPs AMT
Gene Sequence
>1212 bp
ATGCAGAGGGCTGTAAGTGTGGTGGCCCGTCTGGGCTTTCGCCTGCAGGCATTCCCCCCG
GCCTTGTGTCGTCCACTTAGTTGCGCACAGGAGGTGCTCCGCAGGACACCGCTCTATGAC
TTCCACCTGGCCCACGGCGGGAAAATGGTGGCGTTTGCGGGTTGGAGTCTGCCAGTGCAG
TACCGGGACAGTCACACTGACTCGCACCTGCACACACGCCAGCACTGCTCGCTCTTTGAC
GTGTCTCATATGCTGCAGACCAAGATACTTGGTAGTGACCGGGTGAAGCTGATGGAGAGT
CTAGTGGTTGGAGACATTGCAGAGCTAAGACCAAACCAGGGGACACTGTCGCTGTTTACC
AACGAGGCTGGAGGCATCTTAGATGACTTGATTGTAACCAATACTTCTGAGGGCCACCTG
TATGTGGTGTCCAACGCTGGCTGCTGGGAGAAAGATTTGGCCCTCATGCAGGACAAGGTC
AGGGAGCTTCAGAACCAGGGCAGAGATGTGGGCCTGGAGGTGTTGGATAATGCCCTGCTA
GCTCTGCAAGGCCCCACTGCAGCCCAGGTACTACAGGCCGGCGTGGCAGATGACCTGAGG
AAACTGCCCTTCATGACCAGTGCTGTGATGGAGGTGTTTGGCGTGTCTGGCTGCCGCGTG
ACCCGCTGTGGCTACACAGGAGAGGATGGTGTGGAGATCTCGGTGCCGGTAGCGGGGGCA
GTTCACCTGGCAACAGCTATTCTGAAAAACCCAGAGGTGAAGCTGGCAGGGCTGGCAGCC
AGGGACAGCCTGCGCCTGGAGGCAGGCCTCTGCCTGTATGGGAATGACATTGATGAACAC
ACTACACCTGTGGAGGGCAGCCTCAGTTGGACACTGGGGAAGCGCCGCCGAGCTGCTATG
GACTTCCCTGGAGCCAAGGTCATTGTTCCCCAGCTGAAGGGCAGGGTGCAGCGGAGGCGT
GTGGGGTTGATGTGTGAGGGGGCCCCCATGCGGGCACACAGTCCCATCCTGAACATGGAG
GGTACCAAGATTGGTACTGTGACTAGTGGCTGCCCCTCCCCCTCTCTGAAGAAGAATGTG
GCGATGGGTTATGTGCCCTGCGAGTACAGTCGTCCAGGGACAATGCTGCTGGTAGAGGTG
CGGCGGAAGCAGCAGATGGCTGTAGTCAGCAAGATGCCCTTTGTGCCCACAAACTACTAT
ACCCTCAAGTGA
Protein Properties
Number of Residues 403
Molecular Weight 43945.65
Theoretical pI 8.566
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Aminomethyltransferase, mitochondrial
MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
YRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFT
NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGA
VHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV
AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
GenBank ID Protein 158254632
UniProtKB/Swiss-Prot ID P48728
UniProtKB/Swiss-Prot Entry Name GCST_HUMAN
PDB IDs
GenBank Gene ID AK290600
GeneCard ID AMT
GenAtlas ID AMT
HGNC ID HGNC:473
References
General References Not Available