| Identification |
|---|
| HMDB Protein ID
| CDBP00562 |
| Secondary Accession Numbers
| Not Available |
| Name
| Ubiquitin-conjugating enzyme E2 B |
| Description
| Not Available |
| Synonyms
|
- HR6B
- RAD6 homolog B
- Ubiquitin carrier protein B
- Ubiquitin-conjugating enzyme E2-17 kDa
- Ubiquitin-protein ligase B
- hHR6B
|
| Gene Name
| UBE2B |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Involved in ATP binding |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth.
|
| GO Classification
|
| Biological Process |
| positive regulation of reciprocal meiotic recombination |
| cellular response to insulin stimulus |
| negative regulation of apoptotic process |
| response to UV |
| protein stabilization |
| canonical Wnt receptor signaling pathway |
| in utero embryonic development |
| postreplication repair |
| protein K48-linked ubiquitination |
| negative regulation of cAMP-mediated signaling |
| protein K11-linked ubiquitination |
| proteasomal ubiquitin-dependent protein catabolic process |
| protein monoubiquitination |
| response to hypoxia |
| response to drug |
| maintenance of chromatin silencing |
| protein K63-linked ubiquitination |
| histone H2A ubiquitination |
| protein autoubiquitination |
| chiasma assembly |
| histone lysine demethylation |
| negative regulation of histone phosphorylation |
| sperm axoneme assembly |
| spermatogenesis |
| synaptonemal complex organization |
| Cellular Component |
| cytoplasm |
| plasma membrane |
| nucleus |
| replication fork |
| HULC complex |
| XY body |
| nuclear chromatin |
| Function |
| small conjugating protein ligase activity |
| ligase activity |
| ligase activity, forming carbon-nitrogen bonds |
| acid-amino acid ligase activity |
| catalytic activity |
| Molecular Function |
| ubiquitin-protein ligase activity |
| ATP binding |
| Process |
| metabolic process |
| regulation of protein metabolic process |
| macromolecule metabolic process |
| biological regulation |
| regulation of biological process |
| regulation of metabolic process |
| regulation of macromolecule metabolic process |
| post-translational protein modification |
| macromolecule modification |
| protein modification process |
|
| Cellular Location
|
- Cell membrane
- Nucleus
|
| Pathways
|
| Name | SMPDB/Pathwhiz | KEGG | | protein ubiquitination | Not Available | Not Available | | Ubiquitin mediated proteolysis | Not Available |  |
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5q31.1 |
| SNPs
| UBE2B |
| Gene Sequence
|
>459 bp
ATGTCGACCCCGGCCCGGAGGAGGCTCATGCGGGATTTCAAGCGGTTACAAGAGGACCCA
CCTGTGGGTGTCAGTGGCGCACCATCTGAAAACAACATCATGCAGTGGAATGCAGTTATA
TTTGGACCAGAAGGGACACCTTTTGAAGATGGTACTTTTAAACTAGTAATAGAATTTTCT
GAAGAATATCCAAATAAACCACCAACTGTTAGGTTTTTATCCAAAATGTTTCATCCAAAT
GTGTATGCTGATGGTAGCATATGTTTAGATATCCTTCAGAATCGATGGAGTCCAACATAT
GATGTATCTTCTATCTTAACATCAATTCAGTCTCTGCTGGATGAACCGAATCCTAACAGT
CCAGCCAATAGCCAGGCAGCACAGCTTTATCAGGAAAACAAACGAGAATATGAGAAAAGA
GTTTCGGCCATTGTTGAACAAAGCTGGAATGATTCATAA
|
| Protein Properties |
|---|
| Number of Residues
| 152 |
| Molecular Weight
| 17312.205 |
| Theoretical pI
| 4.999 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Ubiquitin-conjugating enzyme E2 B
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P63146 |
| UniProtKB/Swiss-Prot Entry Name
| UBE2B_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| M74525 |
| GeneCard ID
| UBE2B |
| GenAtlas ID
| UBE2B |
| HGNC ID
| HGNC:12473 |
| References |
|---|
| General References
| Not Available |