Identification
HMDB Protein ID CDBP00522
Secondary Accession Numbers Not Available
Name 3-oxo-5-beta-steroid 4-dehydrogenase
Description Not Available
Synonyms
  1. Aldo-keto reductase family 1 member D1
  2. Delta(4)-3-ketosteroid 5-beta-reductase
  3. Delta(4)-3-oxosteroid 5-beta-reductase
Gene Name AKR1D1
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7-alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4-cholesten-3-one can also act as substrates.
GO Classification
Biological Process
bile acid catabolic process
C21-steroid hormone metabolic process
cholesterol catabolic process
oxidation-reduction process
bile acid biosynthetic process
digestion
androgen metabolic process
Cellular Component
cytosol
Function
catalytic activity
oxidoreductase activity
Molecular Function
delta4-3-oxosteroid 5beta-reductase activity
3-oxo-5-beta-steroid 4-dehydrogenase activity
steroid binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Cytoplasm
Pathways
Gene Properties
Chromosome Location 7
Locus 7q32-q33
SNPs AKR1D1
Gene Sequence
>981 bp
ATGGATCTCAGTGCTGCAAGTCACCGCATACCTCTAAGTGATGGAAACAGCATTCCCATC
ATCGGACTTGGTACCTACTCAGAACCTAAATCGACCCCTAAGGGAGCCTGTGCAACATCG
GTGAAGGTTGCTATTGACACAGGGTACCGACATATTGATGGGGCCTACATCTACCAAAAT
GAACACGAAGTTGGGGAGGCCATCAGGGAGAAGATAGCAGAAGGAAAGGTGCGGAGGGAA
GATATCTTCTACTGTGGAAAGCTATGGGCTACAAATCATGTCCCAGAGATGGTCCGCCCA
ACCCTGGAGAGGACACTCAGGGTCCTCCAGCTAGATTATGTGGATCTTTACATCATTGAA
GTACCCATGGCCTTTAAGCCAGGAGATGAAATATACCCTAGAGATGAGAATGGCAAATGG
TTATATCACAAGTCAAATCTGTGTGCCACTTGGGAGGCGATGGAAGCTTGCAAAGACGCT
GGCTTGGTGAAATCCCTGGGAGTGTCCAATTTTAACCGCAGGCAGCTGGAGCTCATCCTG
AACAAGCCAGGACTCAAACACAAGCCAGTCAGCAACCAGGTTGAGTGCCATCCGTATTTC
ACCCAGCCAAAACTCTTGAAATTTTGCCAACAACATGACATTGTCATTACTGCATATAGC
CCTTTGGGGACCAGTAGGAATCCAATCTGGGTGAATGTTTCTTCTCCACCTTTGTTAAAG
GATGCACTTCTAAACTCATTGGGGAAAAGGTACAATAAGACAGCAGCTCAAATTGTTTTG
CGTTTCAACATCCAGCGAGGGGTGGTTGTCATTCCTAAAAGCTTTAATCTTGAAAGGATC
AAAGAAAATTTTCAGATCTTTGACTTTTCTCTCACTGAAGAAGAAATGAAGGACATTGAA
GCCTTGAATAAAAATGTCCGCTTTGTAGAATTGCTCATGTGGCGCGATCATCCTGAATAC
CCATTTCATGATGAATACTGA
Protein Properties
Number of Residues 326
Molecular Weight 32889.38
Theoretical pI 6.619
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>3-oxo-5-beta-steroid 4-dehydrogenase
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQN
EHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIE
VPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELIL
NKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLK
DALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE
ALNKNVRFVELLMWRDHPEYPFHDEY
GenBank ID Protein 431857
UniProtKB/Swiss-Prot ID P51857
UniProtKB/Swiss-Prot Entry Name AK1D1_HUMAN
PDB IDs
GenBank Gene ID Z28339
GeneCard ID AKR1D1
GenAtlas ID AKR1D1
HGNC ID HGNC:388
References
General References Not Available