Identification
HMDB Protein ID CDBP00384
Secondary Accession Numbers Not Available
Name Lactoylglutathione lyase
Description Not Available
Synonyms
  1. Aldoketomutase
  2. Glx I
  3. Glyoxalase I
  4. Ketone-aldehyde mutase
  5. Methylglyoxalase
  6. S-D-lactoylglutathione methylglyoxal lyase
Gene Name GLO1
Protein Type Enzyme
Biological Properties
General Function Involved in lactoylglutathione lyase activity
Specific Function Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B.
GO Classification
Biological Process
methylglyoxal metabolic process
glutathione metabolic process
regulation of transcription from RNA polymerase II promoter
carbohydrate metabolic process
negative regulation of apoptotic process
Cellular Component
cytoplasm
Function
carbon-sulfur lyase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
lyase activity
lactoylglutathione lyase activity
Molecular Function
metal ion binding
lactoylglutathione lyase activity
Cellular Location Not Available
Pathways
Gene Properties
Chromosome Location 6
Locus 6p21.3-p21.1
SNPs GLO1
Gene Sequence
>555 bp
ATGGCAGAACCGCAGCCCCCGTCCGGCGGCCTCACGGACGAGGCCGCCCTCAGTTGCTGC
TCCGACGCGGACCCCAGTACCAAGGATTTTCTATTGCAGCAGACCATGCTACGAGTGAAG
GATCCTAAGAAGTCACTGGATTTTTATACTAGAGTTCTTGGAATGACGCTAATCCAAAAA
TGTGATTTTCCCATTATGAAGTTTTCACTCTACTTCTTGGCTTATGAGGATAAAAATGAC
ATCCCTAAAGAAAAAGATGAAAAAATAGCCTGGGCGCTCTCCAGAAAAGCTACACTTGAG
CTGACACACAATTGGGGCACTGAAGATGATGCGACCCAGAGTTACCACAATGGCAATTCA
GACCCTCGAGGATTCGGTCATATTGGAATTGCTGTTCCTGATGTATACAGTGCTTGTAAA
AGGTTTGAAGAACTGGGAGTCAAATTTGTGAAGAAACCTGATGATGGTAAAATGAAAGGC
CTGGCATTTATTCAAGATCCTGATGGCTACTGGATTGAAATTTTGAATCCTAACAAAATG
GCAACCTTAATGTAG
Protein Properties
Number of Residues 184
Molecular Weight 20777.515
Theoretical pI 5.309
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Lactoylglutathione lyase
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
GenBank ID Protein 5020074
UniProtKB/Swiss-Prot ID Q04760
UniProtKB/Swiss-Prot Entry Name LGUL_HUMAN
PDB IDs
GenBank Gene ID AF146651
GeneCard ID GLO1
GenAtlas ID GLO1
HGNC ID HGNC:4323
References
General References Not Available