Identification
HMDB Protein ID CDBP00184
Secondary Accession Numbers Not Available
Name NADH-ubiquinone oxidoreductase chain 6
Description Not Available
Synonyms
  1. NADH dehydrogenase subunit 6
Gene Name MT-ND6
Protein Type Enzyme
Biological Properties
General Function Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
GO Classification
Biological Process
response to hydrogen peroxide
small molecule metabolic process
mitochondrial electron transport, NADH to ubiquinone
Cellular Component
mitochondrial respiratory chain complex I
integral to membrane
Function
catalytic activity
nadh dehydrogenase activity
nadh dehydrogenase (quinone) activity
nadh dehydrogenase (ubiquinone) activity
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
Molecular Function
NADH dehydrogenase (ubiquinone) activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Multi-pass membrane protein (Potential)
  2. Mitochondrion membrane
Pathways
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs MT-ND6
Gene Sequence
>525 bp
ATGATGTATGCTTTGTTTCTGTTGAGTGTGGGTTTAGTAATGGGGTTTGTGGGGTTTTCT
TCTAAGCCTTCTCCTATTTATGGGGGTTTAGTATTGATTGTTAGCGGTGTGGTCGGGTGT
GTTATTATTCTGAATTTTGGGGGAGGTTATATGGGTTTAATAGTTTTTTTAATTTATTTA
GGGGGAATGATGGTTGTCTTTGGATATACTACAGCGATGGCTATTGAGGAGTATCCTGAG
GCATGGGGGTCAGGGGTTGAGGTCTTGGTGAGTGTTTTAGTGGGGTTAGCGATGGAGGTA
GGATTCGTCCTGTGGGTGAAAGAGTATGATGGGGTGGTGGTTGTGGTAAACTTTAATAGT
GTAGGAAGCTGAATAATTTATGAAGGAGAGGGGTCAGGGTTCATTCGGGAGGATCCTATT
GGTGCGGGGGCTTTGTATGATTATGGGCGTTGATTAGTAGTAGTTACTGGTTGACCATTG
TTTGTTGGTGTATATATTGTAATTGAGATTGCTCGGGGGAATAGG
Protein Properties
Number of Residues 174
Molecular Weight 18622.045
Theoretical pI 4.206
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH-ubiquinone oxidoreductase chain 6
MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL
GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS
VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN
GenBank ID Protein 13015
UniProtKB/Swiss-Prot ID P03923
UniProtKB/Swiss-Prot Entry Name NU6M_HUMAN
PDB IDs Not Available
GenBank Gene ID V00662
GeneCard ID MT-ND6
GenAtlas ID MT-ND6
HGNC ID HGNC:7462
References
General References Not Available