Identification
HMDB Protein ID CDBP00181
Secondary Accession Numbers Not Available
Name NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Description Not Available
Synonyms
  1. CI-51kD
  2. Complex I-51kD
  3. NADH dehydrogenase flavoprotein 1
  4. NADH-ubiquinone oxidoreductase 51 kDa subunit
Gene Name NDUFV1
Protein Type Enzyme
Biological Properties
General Function Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
GO Classification
Biological Process
small molecule metabolic process
mitochondrial electron transport, NADH to ubiquinone
Cellular Component
mitochondrial respiratory chain complex I
Function
binding
nucleotide binding
catalytic activity
nadh dehydrogenase activity
nad or nadh binding
nadh dehydrogenase (quinone) activity
nadh dehydrogenase (ubiquinone) activity
metal cluster binding
iron-sulfur cluster binding
4 iron, 4 sulfur cluster binding
fmn binding
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
Molecular Function
FMN binding
NADH dehydrogenase (ubiquinone) activity
NAD binding
metal ion binding
4 iron, 4 sulfur cluster binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Peripheral membrane protein
  2. Mitochondrion inner membrane
  3. Matrix side
Pathways
Gene Properties
Chromosome Location 11
Locus 11q13
SNPs NDUFV1
Gene Sequence
>1395 bp
ATGCTGGCAACACGGCGGCTGCTCGGCTGGTCGCTTCCCGCGCGGGTATCTGTGCGTTTC
AGCGGCGACACGACAGCACCCAAGAAAACCTCATTTGGCTCGCTGAAGGATGAAGACCGG
ATTTTCACCAACCTGTACGGCCGCCATGACTGGAGGCTGAAAGGTTCCCTGAGTCGAGGT
GACTGGTACAAGACAAAGGAGATCCTGCTGAAGGGGCCCGACTGGATCCTGGGCGAGATC
AAGACATCGGGTTTGAGGGGCCGTGGAGGCGCTGGCTTCCCCACTGGCCTCAAGTGGAGC
TTCATGAATAAGCCCTCAGATGGCAGGCCCAAGTATCTGGTGGTGAACGCAGACGAGGGG
GAGCCGGGCACCTGCAAGGACCGGGAGATCTTACGCCATGATCCTCACAAGCTGCTGGAA
GGCTGCCTGGTGGGGGGCCGGGCCATGGGCGCCCGCGCTGCCTATATCTACATCCGAGGG
GAATTCTACAATGAGGCCTCCAATCTGCAGGTGGCCATCCGAGAGGCCTATGAGGCAGGT
CTGATTGGCAAGAATGCTTGTGGCTCTGGCTATGATTTTGACGTGTTTGTGGTGCGCGGG
GCTGGGGCCTACATCTGTGGAGAGGAGACAGCGCTCATCGAGTCCATTGAGGGCAAGCAG
GGCAAGCCCCGCCTGAAGCCCCCCTTCCCCGCAGACGTGGGAGTGTTTGGCTGCCCCACA
ACTGTGGCCAACGTGGAGACAGTGGCAGTGTCCCCCACAATCTGCCGCCGTGGAGGTACC
TGGTTTGCTGGCTTTGGCAGAGAACGCAACTCAGGCACCAAACTATTCAACATCTCTGGC
CATGTCAACCACCCTTGCACTGTGGAGGAGGAGATGTCTGTGCCCTTGAAAGAACTGATT
GAGAAGCATGCTGGGGGTGTCACGGGCGGCTGGGACAACCTCCTTGCTGTGATCCCTGGC
GGCTCGTCTACCCCACTGATCCCCAAGTCTGTGTGTGAGACGGTGCTGATGGACTTCGAT
GCGCTGGTGCAGGCACAGACAGGCCTGGGCACAGCTGCGGTGATCGTCATGGACCGCTCG
ACGGACATCGTGAAAGCCATCGCCCGCCTCATTGAGTTCTATAAGCACGAGAGCTGTGGC
CAGTGTACCCCATGCCGTGAGGGTGTGGACTGGATGAACAAGGTGATGGCACGTTTCGTG
AGGGGGGATGCCCGGCCGGCCGAGATCGACTCCCTGTGGGAGATCAGCAAGCAGATAGAA
GGCCATACGATTTGTGCTCTGGGTGACGGGGCCGCCTGGCCTGTGCAGGGTCTGATCCGC
CACTTTCGGCCGGAGCTCGAGGAGCGGATGCAGCGGTTTGCCCAGCAGCATCAGGCCCGG
CAGGCTGCCTCTTAG
Protein Properties
Number of Residues 464
Molecular Weight 49867.66
Theoretical pI 8.204
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
GenBank ID Protein 3095113
UniProtKB/Swiss-Prot ID P49821
UniProtKB/Swiss-Prot Entry Name NDUV1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF053070
GeneCard ID NDUFV1
GenAtlas ID NDUFV1
HGNC ID HGNC:7716
References
General References Not Available