Identification
HMDB Protein ID CDBP00177
Secondary Accession Numbers Not Available
Name NADH-ubiquinone oxidoreductase chain 3
Description Not Available
Synonyms
  1. NADH dehydrogenase subunit 3
Gene Name MT-ND3
Protein Type Enzyme
Biological Properties
General Function Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
GO Classification
Biological Process
small molecule metabolic process
response to light intensity
mitochondrial electron transport, NADH to ubiquinone
response to hormone stimulus
response to oxidative stress
Cellular Component
mitochondrial respiratory chain complex I
integral to membrane
Function
oxidoreductase activity, acting on nadh or nadph
catalytic activity
nadh dehydrogenase activity
nadh dehydrogenase (quinone) activity
nadh dehydrogenase (ubiquinone) activity
oxidoreductase activity
Molecular Function
NADH dehydrogenase (ubiquinone) activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion membrane
  2. Multi-pass membrane protein
Pathways
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs MT-ND3
Gene Sequence
>346 bp
ATAAACTTCGCCTTAATTTTAATAATCAACACCCTCCTAGCCTTACTACTAATAATTATT
ACATTTTGACTACCACAACTCAACGGCTACATAGAAAAATCCACCCCTTACGAGTGCGGC
TTCGACCCTATATCCCCCGCCCGCGTCCCTTTCTCCATAAAATTCTTCTTAGTAGCTATT
ACCTTCTTATTATTTGATCTAGAAATTGCCCTCCTTTTACCCCTACCATGAGCCCTACAA
ACAACTAACCTGCCACTAATAGTTATGTCATCCCTCTTATTAATCATCATCCTAGCCCTA
AGTCTGGCCTATGAGTGACTACAAAAAGGATTAGACTGAACCGAAT
Protein Properties
Number of Residues 115
Molecular Weight 13185.87
Theoretical pI 4.41
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH-ubiquinone oxidoreductase chain 3
MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAI
TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P03897
UniProtKB/Swiss-Prot Entry Name NU3M_HUMAN
PDB IDs Not Available
GenBank Gene ID J01415
GeneCard ID MT-ND3
GenAtlas ID MT-ND3
HGNC ID HGNC:7458
References
General References Not Available