Identification
HMDB Protein ID CDBP00171
Secondary Accession Numbers Not Available
Name Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
Description Not Available
Synonyms
  1. ETF dehydrogenase
  2. ETF-QO
  3. ETF-ubiquinone oxidoreductase
  4. Electron-transferring-flavoprotein dehydrogenase
Gene Name ETFDH
Protein Type Enzyme
Biological Properties
General Function Involved in electron-transferring-flavoprotein dehydrogenase activity
Specific Function Accepts electrons from ETF and reduces ubiquinone.
GO Classification
Biological Process
response to oxidative stress
fatty acid beta-oxidation using acyl-CoA dehydrogenase
respiratory electron transport chain
Cellular Component
mitochondrial matrix
integral to mitochondrial inner membrane
Function
catalytic activity
oxidoreductase activity, acting on the ch-nh group of donors
oxidoreductase activity, acting on the ch-nh group of donors, quinone or similar compound as acceptor
electron-transferring-flavoprotein dehydrogenase activity
oxidoreductase activity
Molecular Function
oxidoreductase activity, oxidizing metal ions with flavin as acceptor
flavin adenine dinucleotide binding
ubiquinone binding
electron carrier activity
metal ion binding
4 iron, 4 sulfur cluster binding
electron-transferring-flavoprotein dehydrogenase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion inner membrane
Pathways
Gene Properties
Chromosome Location 4
Locus 4q32-q35
SNPs ETFDH
Gene Sequence
>1854 bp
ATGCTGGTGCCGCTAGCCAAGCTGTCCTGCCTGGCATATCAGTGCTTTCATGCCTTAAAA
ATTAAGAAAAATTATCTACCTCTATGTGCTACAAGATGGTCTTCAACTTCTACTGTGCCT
CGAATTACTACCCATTATACTATTTATCCCCGGGATAAGGACAAGAGATGGGAAGGAGTG
AACATGGAAAGGTTTGCAGAAGAAGCAGATGTTGTAATAGTTGGTGCAGGCCCTGCAGGG
CTCTCTGCAGCTGTTCGTCTAAAACAGTTGGCTGTGGCACATGAAAAGGACATCCGTGTG
TGTCTAGTGGAGAAAGCTGCCCAGATAGGAGCTCATACTCTCTCAGGGGCTTGCCTTGAT
CCAGGTGCTTTTAAAGAACTCTTCCCAGACTGGAAAGAGAAGGGGGCTCCACTTAACACT
CCTGTAACAGAAGACAGATTTGGAATTTTAACAGAGAAATACAGAATTCCTGTGCCAATT
CTTCCAGGGCTTCCAATGAATAATCATGGCAATTACATTGTACGCTTGGGACATTTAGTG
AGCTGGATGGGCGAACAAGCAGAAGCCCTTGGTGTTGAAGTATACCCTGGTTATGCAGCT
GCTGAGGTCCTTTTTCATGATGATGGTAGTGTAAAAGGAATTGCCACTAACGATGTAGGG
ATACAAAAGGATGGTGCACCAAAGGCAACATTTGAGAGAGGACTGGAACTACATGCTAAA
GTCACAATTTTTGCAGAAGGTTGCCATGGACATCTAGCCAAGCAACTATATAAGAAGTTT
GATTTGAGAGCAAATTGTGAACCTCAAACCTACGGGATTGGACTGAAGGAGTTATGGGTT
ATTGATGAAAAGAACTGGAAACCTGGGAGAGTAGATCACACTGTTGGTTGGCCCTTGGAC
AGACATACCTATGGAGGATCTTTCCTCTATCATTTGAATGAAGGTGAACCCCTAGTAGCT
CTTGGTCTTGTGGTTGGTCTAGACTATCAGAATCCATACCTGAGTCCATTTAGAGAGTTC
CAAAGGTGGAAACACCATCCTAGCATTCGGCCAACCTTGGAAGGTGGAAAAAGGATTGCA
TACGGAGCCAGAGCTCTCAATGAAGGTGGCTTTCAGTCTATACCAAAACTCACCTTTCCT
GGTGGTTTACTAATTGGTTGTAGTCCTGGTTTTATGAATGTTCCCAAGATCAAAGGTACT
CACACAGCAATGAAAAGTGGAATTTTAGCAGCAGAATCTATTTTTAATCAACTAACTAGT
GAAAATCTCCAATCAAAGACAATAGGACTCCATGTAACTGAATATGAGGACAATTTGAAG
AACTCATGGGTATGGAAAGAGCTATATTCTGTTAGAAATATAAGACCGTCCTGCCACGGA
GTACTGGGTGTATATGGAGGGATGATTTACACTGGAATCTTTTACTGGATATTGAGAGGA
ATGGAGCCGTGGACTCTGAAACATAAAGGTTCTGACTTTGAACGGCTCAAGCCAGCCAAG
GATTGCACACCTATTGAGTATCCAAAACCCGATGGACAGATCAGTTTTGACCTCTTGTCA
TCTGTGGCTCTGAGTGGTACTAATCATGAACATGACCAGCCGGCACACTTAACCTTAAGG
GATGACAGTATACCTGTAAATAGAAATCTGTCGATATATGATGGGCCCGAGCAGCGATTC
TGTCCTGCAGGAGTTTATGAATTTGTACCTGTGGAACAAGGTGATGGATTTCGGTTACAG
ATAAATGCTCAGAACTGTGTACATTGTAAAACATGTGATATTAAAGATCCAAGTCAGAAT
ATTAACTGGGTGGTACCTGAAGGTGGAGGAGGACCTGCTTACAATGGAATGTAA
Protein Properties
Number of Residues 617
Molecular Weight 68494.96
Theoretical pI 7.554
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
GenBank ID Protein 119703746
UniProtKB/Swiss-Prot ID Q16134
UniProtKB/Swiss-Prot Entry Name ETFD_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004453.2
GeneCard ID ETFDH
GenAtlas ID ETFDH
HGNC ID HGNC:3483
References
General References Not Available