Identification
HMDB Protein ID CDBP00157
Secondary Accession Numbers Not Available
Name NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Description Not Available
Synonyms
  1. CI-75kD
  2. Complex I-75kD
Gene Name NDUFS1
Protein Type Enzyme
Biological Properties
General Function Involved in electron carrier activity
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.
GO Classification
Biological Process
mitochondrial electron transport, NADH to ubiquinone
apoptotic process
reactive oxygen species metabolic process
regulation of mitochondrial membrane potential
ATP metabolic process
Cellular Component
mitochondrial respiratory chain complex I
mitochondrial intermembrane space
Component
membrane
cell part
Function
nadh dehydrogenase (quinone) activity
nadh dehydrogenase (ubiquinone) activity
metal cluster binding
iron-sulfur cluster binding
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
binding
catalytic activity
nadh dehydrogenase activity
electron carrier activity
Molecular Function
electron carrier activity
metal ion binding
2 iron, 2 sulfur cluster binding
4 iron, 4 sulfur cluster binding
NADH dehydrogenase (ubiquinone) activity
Process
cellular metabolic process
oxidation reduction
metabolic process
generation of precursor metabolites and energy
electron transport chain
respiratory electron transport chain
atp synthesis coupled electron transport
Cellular Location
  1. Mitochondrion inner membrane
Pathways
Gene Properties
Chromosome Location 2
Locus 2q33-q34
SNPs NDUFS1
Gene Sequence
>2184 bp
ATGTTAAGGATACCTGTAAGAAGGGCCTTAGTAGGCCTTTCTAAGTCTCCTAAAGGATGT
GTTCGAACAACTGCCACAGCAGCAAGCAACTTGATTGAAGTATTTGTTGATGGTCAGTCT
GTCATGGTGGAACCGGGAACGACCGTCCTCCAAGCTTGTGAGAAGGTTGGCATGCAGATC
CCTCGATTCTGTTATCATGAAAGGTTGTCTGTTGCTGGAAACTGCAGGATGTGCCTTGTT
GAAATTGAGAAAGCCCCTAAGGTTGTAGCTGCTTGTGCCATGCCAGTAATGAAGGGTTGG
AATATCCTAACAAACTCAGAAAAATCCAAAAAGGCCAGGGAAGGTGTGATGGAGTTCTTA
TTAGCAAATCACCCATTGGACTGTCCTATTTGTGACCAGGGAGGTGAATGTGATCTGCAG
GACCAGTCCATGATGTTTGGAAATGATAGGAGCCGATTTTTAGAGGGGAAGCGTGCTGTG
GAAGACAAGAACATTGGGCCATTGGTAAAGACCATCATGACAAGATGTATACAGTGTACT
CGCTGCATCAGGTTTGCAAGTGAGATTGCAGGAGTAGATGATTTGGGAACAACAGGCAGA
GGAAATGATATGCAAGTTGGCACATACATTGAAAAGATGTTCATGTCTGAACTGTCTGGG
AATATCATTGATATCTGCCCTGTAGGTGCCCTAACCTCTAAGCCCTATGCCTTTACTGCC
CGGCCTTGGGAAACAAGAAAGACAGAATCCATTGATGTAATGGATGCGGTTGGAAGTAAT
ATTGTGGTTAGCACAAGAACTGGAGAAGTGATGAGGATTTTGCCACGTATGCATGAGGAC
ATCAATGAAGAGTGGATCTCTGATAAAACCAGATTTGCCTATGATGGGCTAAAACGTCAA
AGACTTACCGAGCCAATGGTCAGAAATGAAAAAGGGCTTTTAACCTATACTTCTTGGGAG
GATGCTCTCTCTCGCGTAGCTGGAATGTTGCAGAGTTTTCAAGGCAAAGATGTGGCAGCA
ATTGCAGGTGGCTTGGTGGATGCTGAAGCCCTGGTAGCTCTCAAAGATTTGCTTAATAGA
GTGGACTCTGACACCTTATGCACTGAAGAGGTCTTCCCCACTGCAGGAGCTGGCACAGAT
TTGCGTTCCAATTATCTTCTTAATACTACAATTGCTGGTGTGGAAGAGGCAGATGTTGTT
CTTCTGGTTGGTACAAACCCACGTTTTGAGGCACCACTGTTTAATGCATGGATTCGAAAG
AGCTGGCTGCATAATGACTTAAAAGTGGCCCTTATAGGCAGTCCAGTGGACCTCACTTAC
ACATATGACCACCTGGGAGACTCCCCCAAAATTCTTCAAGACATTGCTTCGGGAAGCCAT
CCATTTAGCCAGGTCCTAAAGGAAGCTAAAAAACCAATGGTGGTTTTAGGCAGTTCTGCA
CTCCAAAGAAATGATGGAGCAGCAATTCTTGCAGCTGTTTCTAGCATTGCACAAAAGATT
CGGATGACTAGTGGTGTTACTGGTGATTGGAAAGTTATGAATATCCTTCATAGGATTGCA
AGTCAAGTAGCTGCTTTGGACCTTGGCTATAAGCCTGGGGTGGAAGCAATTCGGAAGAAC
CCTCCCAAGGTGCTGTTTCTCCTGGGAGCAGATGGAGGTTGTATCACACGACAGGATTTG
CCAAAGGATTGTTTCATTATTTATCAAGGACATCATGGTGATGTTGGGGCTCCCATAGCT
GATGTTATTCTCCCAGGAGCTGCTTACACAGAGAAGTCTGCTACATATGTCAACACTGAG
GGTAGAGCTCAGCAGACTAAGGTAGCAGTGACACCTCCTGGCTTGGCAAGAGAAGACTGG
AAAATTATAAGAGCACTCTCTGAGATTGCTGGAATGACTCTTCCATATGATACTCTGGAT
CAAGTAAGGAACAGATTGGAAGAATTCTCTCCTAATCTTGTTCGATATGATGATATTGAA
GGGGCTAATTACTTCCAGCAAGCAAATGAGCTCTCAAAGCTAGTGAACCAGCAGCTTCTT
GCTGACCCACTTGTTCCACCTCAGCTAACTCTAAAAGACTTCTACATGACAGATTCGATT
AGCAGAGCCTCACAGACAATGGCCAAATGTGTCAAAGCTGTCACAGAGGGTGCCCAGGCA
GTAGAGGAACCATCCATATGCTGA
Protein Properties
Number of Residues 727
Molecular Weight 67523.595
Theoretical pI 5.325
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA
LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
GenBank ID Protein 38079
UniProtKB/Swiss-Prot ID P28331
UniProtKB/Swiss-Prot Entry Name NDUS1_HUMAN
PDB IDs Not Available
GenBank Gene ID X61100
GeneCard ID NDUFS1
GenAtlas ID NDUFS1
HGNC ID HGNC:7707
References
General References Not Available