Identification
HMDB Protein ID CDBP00137
Secondary Accession Numbers Not Available
Name NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Description Not Available
Synonyms
  1. NADH-ubiquinone oxidoreductase 24 kDa subunit
Gene Name NDUFV2
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
GO Classification
Biological Process
small molecule metabolic process
mitochondrial electron transport, NADH to ubiquinone
nervous system development
cardiac muscle tissue development
Cellular Component
mitochondrial respiratory chain complex I
Function
binding
nucleotide binding
catalytic activity
nad or nadh binding
oxidoreductase activity
Molecular Function
electron carrier activity
metal ion binding
2 iron, 2 sulfur cluster binding
NADH dehydrogenase (ubiquinone) activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion inner membrane
Pathways
Gene Properties
Chromosome Location 18
Locus 18p11.22
SNPs NDUFV2
Gene Sequence
>750 bp
ATGTTCTTCTCCGCGGCGCTCCGGGCCCGGGCGGCTGGCCTCACCGCCCACTGGGGAAGA
CATGTAAGGAATTTGCATAAGACAGTTATGCAAAATGGAGCTGGAGGAGCTTTATTTGTG
CACAGAGATACTCCTGAGAATAACCCTGATACTCCATTTGATTTCACACCAGAAAACTAT
AAGAGGATAGAGGCAATTGTAAAAAACTATCCAGAAGGCCATAAAGCAGCAGCTGTTCTT
CCAGTCCTGGATTTAGCCCAAAGGCAGAATGGGTGGTTGCCCATCTCTGCTATGAACAAG
GTTGCAGAAGTTTTACAAGTACCTCCAATGAGAGTATATGAAGTAGCAACTTTTTATACA
ATGTATAATCGAAAGCCAGTTGGAAAGTATCACATTCAGGTCTGCACTACTACACCCTGC
ATGCTTCGAAACTCTGACAGCATACTGGAGGCCATTCAGAAAAAGCTTGGAATAAAGGTT
GGGGAGACTACACCTGACAAACTTTTCACTCTTATAGAAGTGGAATGTTTAGGGGCCTGT
GTGAACGCACCAATGGTTCAAATAAATGACAATTACTATGAGGATTTGACAGCTAAGGAT
ATTGAAGAAATTATTGATGAGCTCAAGGCTGGCAAAATCCCAAAACCAGGGCCAAGGAGT
GGACGCTTCTCTTGTGAGCCAGCTGGAGGTCTTACCTCTTTGACTGAACCACCCAAGGGA
CCTGGATTTGGTGTACAAGCAGGCCTTTAA
Protein Properties
Number of Residues 249
Molecular Weight 27391.36
Theoretical pI 8.067
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
GenBank ID Protein 12804451
UniProtKB/Swiss-Prot ID P19404
UniProtKB/Swiss-Prot Entry Name NDUV2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC001632
GeneCard ID NDUFV2
GenAtlas ID NDUFV2
HGNC ID HGNC:7717
References
General References Not Available