Identification
HMDB Protein ID CDBP00135
Secondary Accession Numbers Not Available
Name NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Description Not Available
Synonyms
  1. CI-30kD
  2. Complex I-30kD
  3. NADH-ubiquinone oxidoreductase 30 kDa subunit
Gene Name NDUFS3
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity, acting on NADH or NADPH
Specific Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
GO Classification
Biological Process
reactive oxygen species metabolic process
induction of apoptosis
negative regulation of cell growth
small molecule metabolic process
mitochondrial electron transport, NADH to ubiquinone
Cellular Component
mitochondrial respiratory chain complex I
Function
catalytic activity
nadh dehydrogenase activity
nadh dehydrogenase (quinone) activity
nadh dehydrogenase (ubiquinone) activity
oxidoreductase activity
oxidoreductase activity, acting on nadh or nadph
Molecular Function
electron carrier activity
NADH dehydrogenase (ubiquinone) activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion inner membrane
Pathways
Gene Properties
Chromosome Location 11
Locus 11p11.11
SNPs NDUFS3
Gene Sequence
>795 bp
ATGGCGGCGGCGGCGGTAGCCAGGCTGTGGTGGCGCGGGATCTTGGGGGCCTCGGCGCTG
ACCAGGGGGACTGGGCGACCCTCCGTTCTGTTGCTGCCGGTGAGGCGGGAGAGCGCCGGG
GCCGACACGCGCCCCACTGTCAGACCACGGAATGATGTGGCCCACAAGCAGCTCTCAGCT
TTTGGAGAGTATGTGGCTGAAATCTTGCCCAAGTATGTCCAACAAGTTCAGGTGTCCTGC
TTCAATGAGTTAGAGGTCTGTATCCATCCTGATGGCGTCATCCCAGTGCTGACTTTCCTC
AGGGATCACACCAATGCACAGTTCAAATCTCTGGTTGACTTGACAGCAGTGGACGTCCCA
ACTCGGCAAAACCGTTTTGAGATTGTCTACAACCTGTTGTCTCTGCGCTTCAACTCACGG
ATCCGTGTGAAGACCTACACAGATGAGCTGACGCCCATTGAGTCTGCTGTCTCTGTGTTC
AAGGCAGCCAACTGGTATGAAAGGGAGATCTGGGACATGTTTGGAGTCTTCTTTGCTAAC
CACCCTGATCTAAGAAGGATCCTGACAGATTATGGCTTCGAGGGACATCCTTTCCGGAAA
GACTTTCCTCTATCTGGCTATGTTGAGTTACGTTATGATGATGAAGTGAAGCGGGTGGTG
GCAGAGCCGGTGGAGTTGGCCCAAGAGTTCCGCAAATTTGACCTGAACAGCCCCTGGGAG
GCTTTCCCAGTCTATCGCCAACCCCCGGAGAGTCTCAAGCTTGAAGCCGGAGACAAGAAG
CCTGATGCCAAGTAG
Protein Properties
Number of Residues 264
Molecular Weight 30241.245
Theoretical pI 7.497
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA
FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP
TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN
HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE
AFPVYRQPPESLKLEAGDKKPDAK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75489
UniProtKB/Swiss-Prot Entry Name NDUS3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF067139
GeneCard ID NDUFS3
GenAtlas ID NDUFS3
HGNC ID HGNC:7710
References
General References Not Available