Identification
HMDB Protein ID CDBP00006
Secondary Accession Numbers Not Available
Name 5'(3')-deoxyribonucleotidase, cytosolic type
Description Not Available
Synonyms
  1. Cytosolic 5',3'-pyrimidine nucleotidase
  2. Deoxy-5'-nucleotidase 1
  3. dNT-1
Gene Name NT5C
Protein Type Enzyme
Biological Properties
General Function Involved in metal ion binding
Specific Function Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
GO Classification
Biological Process
purine nucleobase metabolic process
purine nucleotide catabolic process
pyrimidine nucleobase metabolic process
pyrimidine nucleoside catabolic process
pyrimidine deoxyribonucleotide catabolic process
Cellular Component
cytosol
mitochondrion
nucleus
Function
phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
Molecular Function
5'-nucleotidase activity
metal ion binding
pyrimidine nucleotide binding
Cellular Location
  1. Cytoplasm
Pathways
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs NT5C
Gene Sequence
>606 bp
ATGGCGCGGAGCGTGCGCGTGCTGGTGGACATGGACGGCGTCCTGGCCGACTTCGAGGCC
GGCCTCCTGCGGGGCTTCCGCCGCCGCTTCCCTGAGGAGCCGCACGTGCCGCTGGAGCAA
CGCCGCGGCTTCCTGGCCCGCGAGCAGTACCGCGCCCTGCGGCCCGACCTGGCGGATAAA
GTGGCCAGTGTGTACGAAGCCCCGGGCTTTTTCCTGGACCTGGAGCCCATCCCGGGAGCC
TTGGACGCTGTGCGGGAGATGAACGACCTACCGGACACGCAGGTCTTCATCTGCACCAGC
CCCCTGCTGAAGTACCACCACTGTGTGGGTGAGAAGTACCGCTGGGTGGAGCAGCACCTG
GGGCCCCAGTTCGTAGAACGAATTATCCTGACAAGGGACAAGACGGTGGTCTTGGGGGAC
CTGCTCATTGATGACAAGGACACAGTTCGAGGCCAGGAGGAGACCCCAAGCTGGGAGCAC
ATCTTGTTCACCTGCTGCCACAATCGGCACCTGGTCCTGCCCCCGACAAGGAGACGGCTG
CTCTCCTGGAGTGACAACTGGAGGGAGATCTTAGATAGCAAGCGCGGAGCTGCGCAGCGG
GAATGA
Protein Properties
Number of Residues 201
Molecular Weight Not Available
Theoretical pI Not Available
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>5'(3')-deoxyribonucleotidase, cytosolic type
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADK
VASVYEAPGFFLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHL
GPQFVERIILTRDKTVVLGDLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRL
LSWSDNWREILDSKRGAAQRE
GenBank ID Protein 7524492
UniProtKB/Swiss-Prot ID Q8TCD5
UniProtKB/Swiss-Prot Entry Name NT5C_HUMAN
PDB IDs
GenBank Gene ID AF154829
GeneCard ID NT5C
GenAtlas ID Not Available
HGNC ID HGNC:17144
References
General References Not Available