Identification
HMDB Protein ID CDBP00004
Secondary Accession Numbers Not Available
Name Cytosolic 5'-nucleotidase 1B
Description Not Available
Synonyms
  1. Autoimmune infertility-related protein
  2. Cytosolic 5'-nucleotidase IB
  3. cN-IB
  4. cN1B
Gene Name NT5C1B
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides. Helps to regulate adenosine levels (By similarity).
GO Classification
Biological Process
purine nucleobase metabolic process
purine nucleotide catabolic process
Cellular Component
cytosol
Component
cell part
intracellular part
cytoplasm
Function
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
nucleotide binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
nucleotidase activity
5'-nucleotidase activity
magnesium ion binding
ion binding
Molecular Function
5'-nucleotidase activity
magnesium ion binding
nucleotide binding
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
metabolic process
Cellular Location
  1. Cytoplasm
Pathways
Gene Properties
Chromosome Location 2
Locus 2p24.2
SNPs NT5C1B
Gene Sequence
>1833 bp
ATGAGTCAAACATCTCTCAAACAGAAAAAGAATGAGCCTGGAATGAGGTCCTCAAAAGAG
AGTCTAGAAGCAGAAAAAAGAAAGGAATCTGACAAAACAGGAGTTCGTCTGAGCAATCAG
ATGAGGCGTGCAGTCAATCCGAATCACTCGCTGAGATGTTGCCCCTTCCAGGGTCACTCG
TCGTGTAGACGCTGCCTTTGTGCAGCTGAGGGAACAGCCCTTGGCCCCTGCCACACAATA
CGTATTTATATTCACATGTGCCTGTTGTGGGAGCAGGGCCAGCAGATCACCATGATGAGG
GGATCACAAGAATCATCACTGCGGAAGACAGACTCTCGAGGGTACCTTGTGCGCAGTCAA
TGGTCTAGAATATCCCGGAGCCCATCCACCAAGGCTCCATCCATAGATGAGCCTAGAAGC
AGGAACACCAGTGCTAAGCTCCCCAGCAGCTCCACGAGCTCCCGGACTCCATCCACCTCC
CCAAGCCTGCATGACTCCTCACCGCCGCCGCTGTCCGGGCAGCCCTCGCTCCAGCCACCC
GCGTCGCCCCAGCTGCCCCGGTCGCTGGACTCGCGGCCTCCCACGCCCCCAGAGCCCGAT
CCTGGCTCCCGGCGCAGCACCAAAATGCAAGAGAATCCGGAGGCCTGGGCCCAAGGCATC
GTGCGGGAAATCCGCCAGACCCGGGACTCGCAGCCGCTGGAATATTCGCGCACGTCCCCC
ACCGAGTGGAAGTCCTCCAGCCAGCGCAGGGGGATCTACCCCGCCTCCACCCAGCTGGAC
CGCAACTCTCTGTCCGAGCAGCAGCAGCAGCAGCGGGAGGACGAGGACGACTACGAGGCT
GCCTACTGGGCATCCATGAGGTCGTTCTACGAGAAGAACCCGAGCTGCTCGCGCCCCTGG
CCGCCCAAACCCAAGAACGCCATCACCATTGCTCTCTCATCCTGCGCGCTCTTCAACATG
GTGGACGGCAGGAAAATCTACGAGCAAGAGGGTCTGGAAAAGTACATGGAGTATCAGCTC
ACCAATGAGAACGTCATCCTGACCCCGGGCCCGGCGTTCCGCTTCGTCAAGGCACTACAG
TATGTCAATGCTAGACTCCGTGATCTATATCCTGATGAACAGGACTTATTTGATATTGTA
CTGATGACTAATAACCATGCCCAAGTGGGAGTGCGGCTTATAAACAGCGTCAATCACTAC
GGCTTACTGATTGACCGCTTCTGTCTGACCGGGGGAAAAGACCCCATTGGCTATTTGAAG
GCATATCTTACCAACTTGTATATTGCTGCAGATTCTGAAAAAGTGCAAGAGGCAATACAA
GAAGGTATTGCCTCTGCGACAATGTTTGATGGAGCCAAAGACATGGCTTACTGTGACACT
CAGCTCCGTGTAGCCTTTGATGGGGATGCTGTCCTCTTCTCTGATGAGTCTGAACATTTT
ACCAAGGAGCATGGGCTCGACAAATTCTTCCAGTATGATACATTATGTGAAAGTAAGCCT
CTTGCTCAGGGTCCCCTAAAAGGCTTTCTGGAAGATTTAGGCAGACTGCAAAAGAAGTTC
TATGCCAAAAATGAACGGTTACTTTGTCCTATCAGGACCTACCTGGTTACAGCTAGGAGT
GCAGCCAGTTCAGGCGCCCGTGTGCTGAAGACCCTTCGACGCTGGGGTCTAGAGATAGAC
GAAGCTCTTTTCCTTGCTGGAGCCCCCAAAAGTCCCATCTTGGTGAAGATCCGGCCCCAC
ATCTTCTTTGATGACCACATGTTCCACATTGAAGGGGCACAGAGGTTAGGTTCCATCGCA
GCTTATGGCTTTAATAAAAAATTCAGTAGTTAG
Protein Properties
Number of Residues 610
Molecular Weight 68803.055
Theoretical pI 8.817
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cytosolic 5'-nucleotidase 1B
MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQMRRAVNPNHSLRCCPFQGHS
SCRRCLCAAEGTALGPCHTIRIYIHMCLLWEQGQQITMMRGSQESSLRKTDSRGYLVRSQ
WSRISRSPSTKAPSIDEPRSRNTSAKLPSSSTSSRTPSTSPSLHDSSPPPLSGQPSLQPP
ASPQLPRSLDSRPPTPPEPDPGSRRSTKMQENPEAWAQGIVREIRQTRDSQPLEYSRTSP
TEWKSSSQRRGIYPASTQLDRNSLSEQQQQQREDEDDYEAAYWASMRSFYEKNPSCSRPW
PPKPKNAITIALSSCALFNMVDGRKIYEQEGLEKYMEYQLTNENVILTPGPAFRFVKALQ
YVNARLRDLYPDEQDLFDIVLMTNNHAQVGVRLINSVNHYGLLIDRFCLTGGKDPIGYLK
AYLTNLYIAADSEKVQEAIQEGIASATMFDGAKDMAYCDTQLRVAFDGDAVLFSDESEHF
TKEHGLDKFFQYDTLCESKPLAQGPLKGFLEDLGRLQKKFYAKNERLLCPIRTYLVTARS
AASSGARVLKTLRRWGLEIDEALFLAGAPKSPILVKIRPHIFFDDHMFHIEGAQRLGSIA
AYGFNKKFSS
GenBank ID Protein 50593110
UniProtKB/Swiss-Prot ID Q96P26
UniProtKB/Swiss-Prot Entry Name 5NT1B_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001002006.2
GeneCard ID NT5C1B
GenAtlas ID NT5C1B
HGNC ID HGNC:17818
References
General References Not Available