Identification
HMDB Protein ID CDBP00001
Secondary Accession Numbers Not Available
Name 5'-nucleotidase
Description Not Available
Synonyms
  1. 5'-NT
  2. CD73 antigen
  3. Ecto-5'-nucleotidase
Gene Name NT5E
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity
Specific Function Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
GO Classification
Biological Process
purine nucleobase metabolic process
purine nucleotide catabolic process
pyrimidine nucleobase metabolic process
pyrimidine nucleoside catabolic process
adenosine biosynthetic process
AMP catabolic process
DNA metabolic process
negative regulation of inflammatory response
purine nucleotide biosynthetic process
Cellular Component
extracellular vesicular exosome
plasma membrane
cytoplasm
anchored to membrane
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
nucleotide binding
catalytic activity
hydrolase activity
Molecular Function
ferrous iron binding
5'-nucleotidase activity
nucleotide binding
Process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleotide catabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Pathways
Gene Properties
Chromosome Location 6
Locus 6q14-q21
SNPs NT5E
Gene Sequence
>1725 bp
ATGTGTCCCCGAGCCGCGCGGGCGCCCGCGACGCTACTCCTCGCCCTGGGCGCGGTGCTG
TGGCCTGCGGCTGGCGCCTGGGAGCTTACGATTTTGCACACCAACGACGTGCACAGCCGG
CTGGAGCAGACCAGCGAGGACTCCAGCAAGTGCGTCAACGCCAGCCGCTGCATGGGTGGC
GTGGCTCGGCTCTTCACCAAGGTTCAGCAGATCCGCCGCGCCGAACCCAACGTGCTGCTG
CTGGACGCCGGCGACCAGTACCAGGGCACTATCTGGTTCACCGTGTACAAGGGCGCCGAG
GTGGCGCACTTCATGAACGCCCTGCGCTACGATGCCATGGCACTGGGAAATCATGAATTT
GATAATGGTGTGGAAGGACTGATCGAGCCACTCCTCAAAGAGGCCAAATTTCCAATTCTG
AGTGCAAACATTAAAGCAAAGGGGCCACTAGCATCTCAAATATCAGGACTTTATTTGCCA
TATAAAGTTCTTCCTGTTGGTGATGAAGTTGTGGGAATCGTTGGATACACTTCCAAAGAA
ACCCCTTTTCTCTCAAATCCAGGGACAAATTTAGTGTTTGAAGATGAAATCACTGCATTA
CAACCTGAAGTAGATAAGTTAAAAACTCTAAATGTGAACAAAATTATTGCACTGGGACAT
TCGGGTTTTGAAATGGATAAACTCATCGCTCAGAAAGTGAGGGGTGTGGACGTCGTGGTG
GGAGGACACTCCAACACATTTCTTTACACAGGCAATCCACCTTCCAAAGAGGTGCCTGCT
GGGAAGTACCCATTCATAGTCACTTCTGATGATGGGCGGAAGGTTCCTGTAGTCCAGGCC
TATGCTTTTGGCAAATACCTAGGCTATCTGAAGATCGAGTTTGATGAAAGAGGAAACGTC
ATCTCTTCCCATGGAAATCCCATTCTTCTAAACAGCAGCATTCCTGAAGATCCAAGCATA
AAAGCAGACATTAACAAATGGAGGATAAAATTGGATAATTATTCTACCCAGGAATTAGGG
AAAACAATTGTCTATCTGGATGGCTCCTCTCAATCATGCCGCTTTAGAGAATGCAACATG
GGCAACCTGATTTGTGATGCAATGATTAACAACAACCTGAGACACACGGATGAAATGTTC
TGGAACCACGTATCCATGTGCATTTTAAATGGAGGTGGTATCCGGTCGCCCATTGATGAA
CGCAACAATGGCACAATTACCTGGGAGAACCTGGCTGCTGTATTGCCCTTTGGAGGCACA
TTTGACCTAGTCCAGTTAAAAGGTTCCACCCTGAAGAAGGCCTTTGAGCATAGCGTGCAC
CGCTACGGCCAGTCCACTGGAGAGTTCCTGCAGGTGGGCGGAATCCATGTGGTGTATGAT
CTTTCCCGAAAACCTGGAGACAGAGTAGTCAAATTAGATGTTCTTTGCACCAAGTGTCGA
GTGCCCAGTTATGACCCTCTCAAAATGGACGAGGTATATAAGGTGATCCTCCCAAACTTC
CTGGCCAATGGTGGAGATGGGTTCCAGATGATAAAAGATGAATTATTAAGACATGACTCT
GGTGACCAAGATATCAACGTGGTTTCTACATATATCTCCAAAATGAAAGTAATTTATCCA
GCAGTTGAAGGTCGGATCAAGTTTTCCACAGGAAGTCACTGCCATGGAAGCTTTTCTTTA
ATATTTCTTTCACTTTGGGCAGTGATCTTTGTTTTATACCAATAG
Protein Properties
Number of Residues 574
Molecular Weight 57948.125
Theoretical pI 6.973
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>5'-nucleotidase
MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGG
VARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEF
DNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVV
GGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNM
GNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCR
VPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYP
AVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ
GenBank ID Protein 23897
UniProtKB/Swiss-Prot ID P21589
UniProtKB/Swiss-Prot Entry Name 5NTD_HUMAN
PDB IDs
GenBank Gene ID X55740
GeneCard ID NT5E
GenAtlas ID NT5E
HGNC ID HGNC:8021
References
General References Not Available